Anti ZBED5 pAb (ATL-HPA050994)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050994-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ZBED5
Alternative Gene Name: Buster1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029624: 21%, ENSRNOG00000046254: 26%
Entrez Gene ID: 58486
Uniprot ID: Q49AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC, ChIP |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSR |
| Gene Sequence | IAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSR |
| Gene ID - Mouse | ENSMUSG00000029624 |
| Gene ID - Rat | ENSRNOG00000046254 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZBED5 pAb (ATL-HPA050994) | |
| Datasheet | Anti ZBED5 pAb (ATL-HPA050994) Datasheet (External Link) |
| Vendor Page | Anti ZBED5 pAb (ATL-HPA050994) at Atlas Antibodies |
| Documents & Links for Anti ZBED5 pAb (ATL-HPA050994) | |
| Datasheet | Anti ZBED5 pAb (ATL-HPA050994) Datasheet (External Link) |
| Vendor Page | Anti ZBED5 pAb (ATL-HPA050994) |