Anti ZBED5 pAb (ATL-HPA050994)

Atlas Antibodies

Catalog No.:
ATL-HPA050994-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: zinc finger, BED-type containing 5
Gene Name: ZBED5
Alternative Gene Name: Buster1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029624: 21%, ENSRNOG00000046254: 26%
Entrez Gene ID: 58486
Uniprot ID: Q49AG3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSR
Gene Sequence IAPLLCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVESFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSR
Gene ID - Mouse ENSMUSG00000029624
Gene ID - Rat ENSRNOG00000046254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBED5 pAb (ATL-HPA050994)
Datasheet Anti ZBED5 pAb (ATL-HPA050994) Datasheet (External Link)
Vendor Page Anti ZBED5 pAb (ATL-HPA050994) at Atlas Antibodies

Documents & Links for Anti ZBED5 pAb (ATL-HPA050994)
Datasheet Anti ZBED5 pAb (ATL-HPA050994) Datasheet (External Link)
Vendor Page Anti ZBED5 pAb (ATL-HPA050994)