Anti ZBED3 pAb (ATL-HPA055995)
Atlas Antibodies
- SKU:
- ATL-HPA055995-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZBED3
Alternative Gene Name: MGC15435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 31%, ENSRNOG00000028941: 40%
Entrez Gene ID: 84327
Uniprot ID: Q96IU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL |
Gene Sequence | RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL |
Gene ID - Mouse | ENSMUSG00000038838 |
Gene ID - Rat | ENSRNOG00000028941 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ZBED3 pAb (ATL-HPA055995) | |
Datasheet | Anti ZBED3 pAb (ATL-HPA055995) Datasheet (External Link) |
Vendor Page | Anti ZBED3 pAb (ATL-HPA055995) at Atlas Antibodies |
Documents & Links for Anti ZBED3 pAb (ATL-HPA055995) | |
Datasheet | Anti ZBED3 pAb (ATL-HPA055995) Datasheet (External Link) |
Vendor Page | Anti ZBED3 pAb (ATL-HPA055995) |