Anti ZBED3 pAb (ATL-HPA055995)

Atlas Antibodies

Catalog No.:
ATL-HPA055995-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: zinc finger, BED-type containing 3
Gene Name: ZBED3
Alternative Gene Name: MGC15435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 31%, ENSRNOG00000028941: 40%
Entrez Gene ID: 84327
Uniprot ID: Q96IU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL
Gene Sequence RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL
Gene ID - Mouse ENSMUSG00000038838
Gene ID - Rat ENSRNOG00000028941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ZBED3 pAb (ATL-HPA055995)
Datasheet Anti ZBED3 pAb (ATL-HPA055995) Datasheet (External Link)
Vendor Page Anti ZBED3 pAb (ATL-HPA055995) at Atlas Antibodies

Documents & Links for Anti ZBED3 pAb (ATL-HPA055995)
Datasheet Anti ZBED3 pAb (ATL-HPA055995) Datasheet (External Link)
Vendor Page Anti ZBED3 pAb (ATL-HPA055995)