Anti ZBED3 pAb (ATL-HPA055995)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055995-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ZBED3
Alternative Gene Name: MGC15435
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038838: 31%, ENSRNOG00000028941: 40%
Entrez Gene ID: 84327
Uniprot ID: Q96IU2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL |
| Gene Sequence | RELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL |
| Gene ID - Mouse | ENSMUSG00000038838 |
| Gene ID - Rat | ENSRNOG00000028941 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ZBED3 pAb (ATL-HPA055995) | |
| Datasheet | Anti ZBED3 pAb (ATL-HPA055995) Datasheet (External Link) |
| Vendor Page | Anti ZBED3 pAb (ATL-HPA055995) at Atlas Antibodies |
| Documents & Links for Anti ZBED3 pAb (ATL-HPA055995) | |
| Datasheet | Anti ZBED3 pAb (ATL-HPA055995) Datasheet (External Link) |
| Vendor Page | Anti ZBED3 pAb (ATL-HPA055995) |