Anti YY1AP1 pAb (ATL-HPA064249)

Atlas Antibodies

Catalog No.:
ATL-HPA064249-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: YY1 associated protein 1
Gene Name: YY1AP1
Alternative Gene Name: HCCA2, YAP, YY1AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018387: 34%, ENSRNOG00000007431: 34%
Entrez Gene ID: 55249
Uniprot ID: Q9H869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED
Gene Sequence TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED
Gene ID - Mouse ENSMUSG00000018387
Gene ID - Rat ENSRNOG00000007431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YY1AP1 pAb (ATL-HPA064249)
Datasheet Anti YY1AP1 pAb (ATL-HPA064249) Datasheet (External Link)
Vendor Page Anti YY1AP1 pAb (ATL-HPA064249) at Atlas Antibodies

Documents & Links for Anti YY1AP1 pAb (ATL-HPA064249)
Datasheet Anti YY1AP1 pAb (ATL-HPA064249) Datasheet (External Link)
Vendor Page Anti YY1AP1 pAb (ATL-HPA064249)