Anti YY1AP1 pAb (ATL-HPA064249)

Atlas Antibodies

SKU: ATL-HPA064249-25

• 

Protein Description: YY1 associated protein 1
Gene Name: YY1AP1
Alternative Gene Name: HCCA2, YAP, YY1AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018387: 34%, ENSRNOG00000007431: 34%
Entrez Gene ID: 55249
Uniprot ID: Q9H869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED
• Gene Sequence: TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED
• Gene ID - Mouse: ENSMUSG00000018387
• Gene ID - Rat: ENSRNOG00000007431
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.