Anti YY1AP1 pAb (ATL-HPA064249)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064249-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: YY1AP1
Alternative Gene Name: HCCA2, YAP, YY1AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018387: 34%, ENSRNOG00000007431: 34%
Entrez Gene ID: 55249
Uniprot ID: Q9H869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED |
| Gene Sequence | TNPGSRLTRWPPPDKREGSAVDPGKRRSLAATPSSSLPCTLIALGLRHEKEANELMED |
| Gene ID - Mouse | ENSMUSG00000018387 |
| Gene ID - Rat | ENSRNOG00000007431 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YY1AP1 pAb (ATL-HPA064249) | |
| Datasheet | Anti YY1AP1 pAb (ATL-HPA064249) Datasheet (External Link) |
| Vendor Page | Anti YY1AP1 pAb (ATL-HPA064249) at Atlas Antibodies |
| Documents & Links for Anti YY1AP1 pAb (ATL-HPA064249) | |
| Datasheet | Anti YY1AP1 pAb (ATL-HPA064249) Datasheet (External Link) |
| Vendor Page | Anti YY1AP1 pAb (ATL-HPA064249) |