Anti YY1AP1 pAb (ATL-HPA006986)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006986-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: YY1AP1
Alternative Gene Name: HCCA2, YAP, YY1AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054199: 77%, ENSRNOG00000020297: 76%
Entrez Gene ID: 55249
Uniprot ID: Q9H869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIA |
| Gene Sequence | MEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIA |
| Gene ID - Mouse | ENSMUSG00000054199 |
| Gene ID - Rat | ENSRNOG00000020297 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YY1AP1 pAb (ATL-HPA006986) | |
| Datasheet | Anti YY1AP1 pAb (ATL-HPA006986) Datasheet (External Link) |
| Vendor Page | Anti YY1AP1 pAb (ATL-HPA006986) at Atlas Antibodies |
| Documents & Links for Anti YY1AP1 pAb (ATL-HPA006986) | |
| Datasheet | Anti YY1AP1 pAb (ATL-HPA006986) Datasheet (External Link) |
| Vendor Page | Anti YY1AP1 pAb (ATL-HPA006986) |
| Citations for Anti YY1AP1 pAb (ATL-HPA006986) – 1 Found |
| Zhao, X; Parpart, S; Takai, A; Roessler, S; Budhu, A; Yu, Z; Blank, M; Zhang, Y E; Jia, H-L; Ye, Q-H; Qin, L-X; Tang, Z-Y; Thorgeirsson, S S; Wang, X W. Integrative genomics identifies YY1AP1 as an oncogenic driver in EpCAM(+) AFP(+) hepatocellular carcinoma. Oncogene. 2015;34(39):5095-104. PubMed |