Anti YY1AP1 pAb (ATL-HPA006986)

Atlas Antibodies

Catalog No.:
ATL-HPA006986-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: YY1 associated protein 1
Gene Name: YY1AP1
Alternative Gene Name: HCCA2, YAP, YY1AP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054199: 77%, ENSRNOG00000020297: 76%
Entrez Gene ID: 55249
Uniprot ID: Q9H869
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIA
Gene Sequence MEDDGPEEEERVAEPQANFNTPQALRFEELLANLLNEQHQIAKELFEQLKMKKPSAKQQKEVEKVKPQCKEVHQTLILDPAQRKRLQQQMQQHVQLLTQIHLLATCNPNLNPEASSTRICLKELGTFAQSSIA
Gene ID - Mouse ENSMUSG00000054199
Gene ID - Rat ENSRNOG00000020297
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YY1AP1 pAb (ATL-HPA006986)
Datasheet Anti YY1AP1 pAb (ATL-HPA006986) Datasheet (External Link)
Vendor Page Anti YY1AP1 pAb (ATL-HPA006986) at Atlas Antibodies

Documents & Links for Anti YY1AP1 pAb (ATL-HPA006986)
Datasheet Anti YY1AP1 pAb (ATL-HPA006986) Datasheet (External Link)
Vendor Page Anti YY1AP1 pAb (ATL-HPA006986)
Citations for Anti YY1AP1 pAb (ATL-HPA006986) – 1 Found
Zhao, X; Parpart, S; Takai, A; Roessler, S; Budhu, A; Yu, Z; Blank, M; Zhang, Y E; Jia, H-L; Ye, Q-H; Qin, L-X; Tang, Z-Y; Thorgeirsson, S S; Wang, X W. Integrative genomics identifies YY1AP1 as an oncogenic driver in EpCAM(+) AFP(+) hepatocellular carcinoma. Oncogene. 2015;34(39):5095-104.  PubMed