Anti YWHAB pAb (ATL-HPA011212 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011212-25

Protein Description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
Gene Name: YWHAB
Alternative Gene Name: YWHAA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018326: 96%, ENSRNOG00000010945: 94%
Entrez Gene ID: 7529
Uniprot ID: P31946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
• Gene Sequence: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
• Gene ID - Mouse: ENSMUSG00000018326
• Gene ID - Rat: ENSRNOG00000010945
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YWHAB pAb (ATL-HPA011212 w/enhanced validation) – 2 Found

O'Dwyer, Donna; Ralton, Lynda D; O'Shea, Aisling; Murray, Graeme I. The proteomics of colorectal cancer: identification of a protein signature associated with prognosis. Plos One. 6(11):e27718. 

Syed, Farooq; Singhal, Divya; Raedschelders, Koen; Krishnan, Preethi; Bone, Robert N; McLaughlin, Madeline R; Van Eyk, Jennifer E; Mirmira, Raghavendra G; Yang, Mei-Ling; Mamula, Mark J; Wu, Huanmei; Liu, Xiaowen; Evans-Molina, Carmella. A discovery-based proteomics approach identifies protein disulphide isomerase (PDIA1) as a biomarker of β cell stress in type 1 diabetes. Ebiomedicine. 2023;87( 36463755):104379.