Anti YWHAB pAb (ATL-HPA007925)

Atlas Antibodies

Catalog No.: ATL-HPA007925-100

Protein Description: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
Gene Name: YWHAB
Alternative Gene Name: YWHAA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000076432: 100%, ENSRNOG00000051650: 100%
Entrez Gene ID: 7529
Uniprot ID: P31946
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRY
• Gene Sequence: ELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRY
• Gene ID - Mouse: ENSMUSG00000076432
• Gene ID - Rat: ENSRNOG00000051650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.