Anti YTHDF2 pAb (ATL-HPA054080)

Atlas Antibodies

Catalog No.:
ATL-HPA054080-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: YTH N(6)-methyladenosine RNA binding protein 2
Gene Name: YTHDF2
Alternative Gene Name: CAHL, HGRG8, NY-REN-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040025: 100%, ENSRNOG00000010892: 100%
Entrez Gene ID: 51441
Uniprot ID: Q9Y5A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNY
Gene Sequence RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNY
Gene ID - Mouse ENSMUSG00000040025
Gene ID - Rat ENSRNOG00000010892
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YTHDF2 pAb (ATL-HPA054080)
Datasheet Anti YTHDF2 pAb (ATL-HPA054080) Datasheet (External Link)
Vendor Page Anti YTHDF2 pAb (ATL-HPA054080) at Atlas Antibodies

Documents & Links for Anti YTHDF2 pAb (ATL-HPA054080)
Datasheet Anti YTHDF2 pAb (ATL-HPA054080) Datasheet (External Link)
Vendor Page Anti YTHDF2 pAb (ATL-HPA054080)