Anti YTHDF2 pAb (ATL-HPA054080)

Atlas Antibodies

Catalog No.: ATL-HPA054080-25

Protein Description: YTH N(6)-methyladenosine RNA binding protein 2
Gene Name: YTHDF2
Alternative Gene Name: CAHL, HGRG8, NY-REN-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040025: 100%, ENSRNOG00000010892: 100%
Entrez Gene ID: 51441
Uniprot ID: Q9Y5A9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNY
• Gene Sequence: RNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNY
• Gene ID - Mouse: ENSMUSG00000040025
• Gene ID - Rat: ENSRNOG00000010892
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.