Anti YTHDC2 pAb (ATL-HPA072678)

Atlas Antibodies

Catalog No.:
ATL-HPA072678-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: YTH domain containing 2
Gene Name: YTHDC2
Alternative Gene Name: DKFZp564A186, FLJ10053, FLJ2194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034653: 93%, ENSRNOG00000039241: 76%
Entrez Gene ID: 64848
Uniprot ID: Q9H6S0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHKDIDAFAQVFHLILTENVSVDYRHSETSATA
Gene Sequence TVLNVTDEYDLLDDGGDAVFSQLTEKDVNCLEPWLIKEMDACLSDIWLHKDIDAFAQVFHLILTENVSVDYRHSETSATA
Gene ID - Mouse ENSMUSG00000034653
Gene ID - Rat ENSRNOG00000039241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YTHDC2 pAb (ATL-HPA072678)
Datasheet Anti YTHDC2 pAb (ATL-HPA072678) Datasheet (External Link)
Vendor Page Anti YTHDC2 pAb (ATL-HPA072678) at Atlas Antibodies

Documents & Links for Anti YTHDC2 pAb (ATL-HPA072678)
Datasheet Anti YTHDC2 pAb (ATL-HPA072678) Datasheet (External Link)
Vendor Page Anti YTHDC2 pAb (ATL-HPA072678)