Anti YRDC pAb (ATL-HPA030147)

Atlas Antibodies

Catalog No.:
ATL-HPA030147-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: yrdC N(6)-threonylcarbamoyltransferase domain containing
Gene Name: YRDC
Alternative Gene Name: FLJ23476, IRIP, SUA5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028889: 92%, ENSRNOG00000025424: 89%
Entrez Gene ID: 79693
Uniprot ID: Q86U90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP
Gene Sequence ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP
Gene ID - Mouse ENSMUSG00000028889
Gene ID - Rat ENSRNOG00000025424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YRDC pAb (ATL-HPA030147)
Datasheet Anti YRDC pAb (ATL-HPA030147) Datasheet (External Link)
Vendor Page Anti YRDC pAb (ATL-HPA030147) at Atlas Antibodies

Documents & Links for Anti YRDC pAb (ATL-HPA030147)
Datasheet Anti YRDC pAb (ATL-HPA030147) Datasheet (External Link)
Vendor Page Anti YRDC pAb (ATL-HPA030147)