Anti YJEFN3 pAb (ATL-HPA060789)

Atlas Antibodies

Catalog No.:
ATL-HPA060789-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: YjeF N-terminal domain containing 3
Gene Name: YJEFN3
Alternative Gene Name: FLJ44968, hYjeF_N3-19p13.11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048967: 81%, ENSRNOG00000039191: 81%
Entrez Gene ID: 374887
Uniprot ID: A6XGL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD
Gene Sequence SGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTD
Gene ID - Mouse ENSMUSG00000048967
Gene ID - Rat ENSRNOG00000039191
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YJEFN3 pAb (ATL-HPA060789)
Datasheet Anti YJEFN3 pAb (ATL-HPA060789) Datasheet (External Link)
Vendor Page Anti YJEFN3 pAb (ATL-HPA060789) at Atlas Antibodies

Documents & Links for Anti YJEFN3 pAb (ATL-HPA060789)
Datasheet Anti YJEFN3 pAb (ATL-HPA060789) Datasheet (External Link)
Vendor Page Anti YJEFN3 pAb (ATL-HPA060789)