Anti YIPF7 pAb (ATL-HPA030642)

Atlas Antibodies

Catalog No.: ATL-HPA030642-25

Protein Description: Yip1 domain family, member 7
Gene Name: YIPF7
Alternative Gene Name: FinGER9, FLJ39576
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029158: 95%, ENSRNOG00000002224: 95%
Entrez Gene ID: 285525
Uniprot ID: Q8N8F6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAG
• Gene Sequence: LTVLNPMKPVDGSIMNETDLTGPILFCVALGATLLLAG
• Gene ID - Mouse: ENSMUSG00000029158
• Gene ID - Rat: ENSRNOG00000002224
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.