Anti YIPF6 pAb (ATL-HPA003720)

Atlas Antibodies

Catalog No.:
ATL-HPA003720-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Yip1 domain family, member 6
Gene Name: YIPF6
Alternative Gene Name: FinGER6, MGC21416
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047694: 80%, ENSRNOG00000006642: 78%
Entrez Gene ID: 286451
Uniprot ID: Q96EC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDL
Gene Sequence AGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDL
Gene ID - Mouse ENSMUSG00000047694
Gene ID - Rat ENSRNOG00000006642
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YIPF6 pAb (ATL-HPA003720)
Datasheet Anti YIPF6 pAb (ATL-HPA003720) Datasheet (External Link)
Vendor Page Anti YIPF6 pAb (ATL-HPA003720) at Atlas Antibodies

Documents & Links for Anti YIPF6 pAb (ATL-HPA003720)
Datasheet Anti YIPF6 pAb (ATL-HPA003720) Datasheet (External Link)
Vendor Page Anti YIPF6 pAb (ATL-HPA003720)
Citations for Anti YIPF6 pAb (ATL-HPA003720) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed