Anti YIPF5 pAb (ATL-HPA073622 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA073622-25

• 
• 
• 

Protein Description: Yip1 domain family, member 5
Gene Name: YIPF5
Alternative Gene Name: FinGER5, SMAP-5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024487: 91%, ENSRNOG00000014564: 89%
Entrez Gene ID: 81555
Uniprot ID: Q969M3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD
• Gene Sequence: SGFENLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPD
• Gene ID - Mouse: ENSMUSG00000024487
• Gene ID - Rat: ENSRNOG00000014564
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.