Anti YIPF3 pAb (ATL-HPA014859)

Atlas Antibodies

Catalog No.: ATL-HPA014859-25

Protein Description: Yip1 domain family, member 3
Gene Name: YIPF3
Alternative Gene Name: C6orf109, dJ337H4.3, DKFZp566C243, FinGER3, KLIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071074: 88%, ENSRNOG00000018998: 86%
Entrez Gene ID: 25844
Uniprot ID: Q9GZM5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
• Gene Sequence: GILDTLEGPNIPPIQRVPRDIPAMLPAARLPTTVLNATAKAVAVTLQSH
• Gene ID - Mouse: ENSMUSG00000071074
• Gene ID - Rat: ENSRNOG00000018998
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti YIPF3 pAb (ATL-HPA014859) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.