Anti YIF1B pAb (ATL-HPA055257)

Atlas Antibodies

Catalog No.:
ATL-HPA055257-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Yip1 interacting factor homolog B (S. cerevisiae)
Gene Name: YIF1B
Alternative Gene Name: FinGER8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030588: 77%, ENSRNOG00000055286: 77%
Entrez Gene ID: 90522
Uniprot ID: Q5BJH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITK
Gene Sequence HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITK
Gene ID - Mouse ENSMUSG00000030588
Gene ID - Rat ENSRNOG00000055286
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YIF1B pAb (ATL-HPA055257)
Datasheet Anti YIF1B pAb (ATL-HPA055257) Datasheet (External Link)
Vendor Page Anti YIF1B pAb (ATL-HPA055257) at Atlas Antibodies

Documents & Links for Anti YIF1B pAb (ATL-HPA055257)
Datasheet Anti YIF1B pAb (ATL-HPA055257) Datasheet (External Link)
Vendor Page Anti YIF1B pAb (ATL-HPA055257)