Anti YIF1B pAb (ATL-HPA055257)

Atlas Antibodies

Catalog No.: ATL-HPA055257-25

Protein Description: Yip1 interacting factor homolog B (S. cerevisiae)
Gene Name: YIF1B
Alternative Gene Name: FinGER8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030588: 77%, ENSRNOG00000055286: 77%
Entrez Gene ID: 90522
Uniprot ID: Q5BJH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITK
• Gene Sequence: HQLFDDTSSAQSRGYGAQRAPGGLSYPAASPTPHAAFLADPVSNMAMAYGSSLAAQGKELVDKNIDRFIPITK
• Gene ID - Mouse: ENSMUSG00000030588
• Gene ID - Rat: ENSRNOG00000055286
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.