Anti YIF1A pAb (ATL-HPA014840)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014840-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: YIF1A
Alternative Gene Name: 54TM, FinGER7, YIF1, YIF1P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024875: 93%, ENSRNOG00000020201: 87%
Entrez Gene ID: 10897
Uniprot ID: O95070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
| Gene Sequence | ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ |
| Gene ID - Mouse | ENSMUSG00000024875 |
| Gene ID - Rat | ENSRNOG00000020201 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YIF1A pAb (ATL-HPA014840) | |
| Datasheet | Anti YIF1A pAb (ATL-HPA014840) Datasheet (External Link) |
| Vendor Page | Anti YIF1A pAb (ATL-HPA014840) at Atlas Antibodies |
| Documents & Links for Anti YIF1A pAb (ATL-HPA014840) | |
| Datasheet | Anti YIF1A pAb (ATL-HPA014840) Datasheet (External Link) |
| Vendor Page | Anti YIF1A pAb (ATL-HPA014840) |