Anti YIF1A pAb (ATL-HPA014840)

Atlas Antibodies

Catalog No.: ATL-HPA014840-25

Protein Description: Yip1 interacting factor homolog A (S. cerevisiae)
Gene Name: YIF1A
Alternative Gene Name: 54TM, FinGER7, YIF1, YIF1P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024875: 93%, ENSRNOG00000020201: 87%
Entrez Gene ID: 10897
Uniprot ID: O95070
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
• Gene Sequence: ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
• Gene ID - Mouse: ENSMUSG00000024875
• Gene ID - Rat: ENSRNOG00000020201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.