Anti YEATS4 pAb (ATL-HPA072532)

Atlas Antibodies

SKU:
ATL-HPA072532-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: YEATS domain containing 4
Gene Name: YEATS4
Alternative Gene Name: GAS41, NuBI-1, YAF9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020171: 99%, ENSRNOG00000005689: 96%
Entrez Gene ID: 8089
Uniprot ID: O95619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKD
Gene Sequence QQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKD
Gene ID - Mouse ENSMUSG00000020171
Gene ID - Rat ENSRNOG00000005689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti YEATS4 pAb (ATL-HPA072532)
Datasheet Anti YEATS4 pAb (ATL-HPA072532) Datasheet (External Link)
Vendor Page Anti YEATS4 pAb (ATL-HPA072532) at Atlas Antibodies

Documents & Links for Anti YEATS4 pAb (ATL-HPA072532)
Datasheet Anti YEATS4 pAb (ATL-HPA072532) Datasheet (External Link)
Vendor Page Anti YEATS4 pAb (ATL-HPA072532)