Anti YARS2 pAb (ATL-HPA074097)

Atlas Antibodies

Catalog No.:
ATL-HPA074097-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tyrosyl-tRNA synthetase 2, mitochondrial
Gene Name: YARS2
Alternative Gene Name: CGI-04, FLJ13995, mt-TyrRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022792: 90%, ENSRNOG00000025252: 90%
Entrez Gene ID: 51067
Uniprot ID: Q9Y2Z4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIPDGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSL
Gene Sequence DALEVMSDQELKELFKEAPFSEFFLDPGTSVLDTCRKANAIPDGPRGYRMITEGGVSINHQQVTNPESVLIVGQHILKNGLSL
Gene ID - Mouse ENSMUSG00000022792
Gene ID - Rat ENSRNOG00000025252
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YARS2 pAb (ATL-HPA074097)
Datasheet Anti YARS2 pAb (ATL-HPA074097) Datasheet (External Link)
Vendor Page Anti YARS2 pAb (ATL-HPA074097) at Atlas Antibodies

Documents & Links for Anti YARS2 pAb (ATL-HPA074097)
Datasheet Anti YARS2 pAb (ATL-HPA074097) Datasheet (External Link)
Vendor Page Anti YARS2 pAb (ATL-HPA074097)