Anti YARS pAb (ATL-HPA017936 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA017936-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: tyrosyl-tRNA synthetase
Gene Name: YARS
Alternative Gene Name: tyrRS, YRS, YTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028811: 98%, ENSRNOG00000007213: 97%
Entrez Gene ID: 8565
Uniprot ID: P54577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKK
Gene Sequence SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKK
Gene ID - Mouse ENSMUSG00000028811
Gene ID - Rat ENSRNOG00000007213
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YARS pAb (ATL-HPA017936 w/enhanced validation)
Datasheet Anti YARS pAb (ATL-HPA017936 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti YARS pAb (ATL-HPA017936 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti YARS pAb (ATL-HPA017936 w/enhanced validation)
Datasheet Anti YARS pAb (ATL-HPA017936 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti YARS pAb (ATL-HPA017936 w/enhanced validation)