Anti YARS pAb (ATL-HPA017936 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017936-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: YARS
Alternative Gene Name: tyrRS, YRS, YTS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028811: 98%, ENSRNOG00000007213: 97%
Entrez Gene ID: 8565
Uniprot ID: P54577
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKK |
| Gene Sequence | SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSKMSSSEEESKIDLLDRKEDVKK |
| Gene ID - Mouse | ENSMUSG00000028811 |
| Gene ID - Rat | ENSRNOG00000007213 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YARS pAb (ATL-HPA017936 w/enhanced validation) | |
| Datasheet | Anti YARS pAb (ATL-HPA017936 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti YARS pAb (ATL-HPA017936 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti YARS pAb (ATL-HPA017936 w/enhanced validation) | |
| Datasheet | Anti YARS pAb (ATL-HPA017936 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti YARS pAb (ATL-HPA017936 w/enhanced validation) |