Anti YAP1 pAb (ATL-HPA038885)

Atlas Antibodies

Catalog No.:
ATL-HPA038885-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: Yes-associated protein 1
Gene Name: YAP1
Alternative Gene Name: YAP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053110: 86%, ENSRNOG00000005933: 83%
Entrez Gene ID: 10413
Uniprot ID: P46937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD
Gene Sequence PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD
Gene ID - Mouse ENSMUSG00000053110
Gene ID - Rat ENSRNOG00000005933
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti YAP1 pAb (ATL-HPA038885)
Datasheet Anti YAP1 pAb (ATL-HPA038885) Datasheet (External Link)
Vendor Page Anti YAP1 pAb (ATL-HPA038885) at Atlas Antibodies

Documents & Links for Anti YAP1 pAb (ATL-HPA038885)
Datasheet Anti YAP1 pAb (ATL-HPA038885) Datasheet (External Link)
Vendor Page Anti YAP1 pAb (ATL-HPA038885)