Anti YAP1 pAb (ATL-HPA038885)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038885-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: YAP1
Alternative Gene Name: YAP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053110: 86%, ENSRNOG00000005933: 83%
Entrez Gene ID: 10413
Uniprot ID: P46937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD |
| Gene Sequence | PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD |
| Gene ID - Mouse | ENSMUSG00000053110 |
| Gene ID - Rat | ENSRNOG00000005933 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti YAP1 pAb (ATL-HPA038885) | |
| Datasheet | Anti YAP1 pAb (ATL-HPA038885) Datasheet (External Link) |
| Vendor Page | Anti YAP1 pAb (ATL-HPA038885) at Atlas Antibodies |
| Documents & Links for Anti YAP1 pAb (ATL-HPA038885) | |
| Datasheet | Anti YAP1 pAb (ATL-HPA038885) Datasheet (External Link) |
| Vendor Page | Anti YAP1 pAb (ATL-HPA038885) |