Anti XRCC5 pAb (ATL-HPA064685)

Atlas Antibodies

Catalog No.:
ATL-HPA064685-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Gene Name: XRCC5
Alternative Gene Name: KARP-1, KU80, Ku86, KUB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026187: 85%, ENSRNOG00000016105: 83%
Entrez Gene ID: 7520
Uniprot ID: P13010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
Gene Sequence SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
Gene ID - Mouse ENSMUSG00000026187
Gene ID - Rat ENSRNOG00000016105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XRCC5 pAb (ATL-HPA064685)
Datasheet Anti XRCC5 pAb (ATL-HPA064685) Datasheet (External Link)
Vendor Page Anti XRCC5 pAb (ATL-HPA064685) at Atlas Antibodies

Documents & Links for Anti XRCC5 pAb (ATL-HPA064685)
Datasheet Anti XRCC5 pAb (ATL-HPA064685) Datasheet (External Link)
Vendor Page Anti XRCC5 pAb (ATL-HPA064685)