Anti XRCC5 pAb (ATL-HPA064685)

Atlas Antibodies

Catalog No.: ATL-HPA064685-25

Protein Description: X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
Gene Name: XRCC5
Alternative Gene Name: KARP-1, KU80, Ku86, KUB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026187: 85%, ENSRNOG00000016105: 83%
Entrez Gene ID: 7520
Uniprot ID: P13010
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
• Gene Sequence: SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD
• Gene ID - Mouse: ENSMUSG00000026187
• Gene ID - Rat: ENSRNOG00000016105
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.