Anti XRCC3 pAb (ATL-HPA062422)
Atlas Antibodies
- Catalog No.:
- ATL-HPA062422-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: XRCC3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021287: 55%, ENSRNOG00000012141: 58%
Entrez Gene ID: 7517
Uniprot ID: O43542
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSA |
Gene Sequence | NQVTEAMEEQGAAHGPLGFWDERVSPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSA |
Gene ID - Mouse | ENSMUSG00000021287 |
Gene ID - Rat | ENSRNOG00000012141 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti XRCC3 pAb (ATL-HPA062422) | |
Datasheet | Anti XRCC3 pAb (ATL-HPA062422) Datasheet (External Link) |
Vendor Page | Anti XRCC3 pAb (ATL-HPA062422) at Atlas Antibodies |
Documents & Links for Anti XRCC3 pAb (ATL-HPA062422) | |
Datasheet | Anti XRCC3 pAb (ATL-HPA062422) Datasheet (External Link) |
Vendor Page | Anti XRCC3 pAb (ATL-HPA062422) |