Anti XPR1 pAb (ATL-HPA016557)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016557-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: XPR1
Alternative Gene Name: SYG1, X3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026469: 99%, ENSRNOG00000000042: 97%
Entrez Gene ID: 9213
Uniprot ID: Q9UBH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT |
| Gene Sequence | RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT |
| Gene ID - Mouse | ENSMUSG00000026469 |
| Gene ID - Rat | ENSRNOG00000000042 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti XPR1 pAb (ATL-HPA016557) | |
| Datasheet | Anti XPR1 pAb (ATL-HPA016557) Datasheet (External Link) |
| Vendor Page | Anti XPR1 pAb (ATL-HPA016557) at Atlas Antibodies |
| Documents & Links for Anti XPR1 pAb (ATL-HPA016557) | |
| Datasheet | Anti XPR1 pAb (ATL-HPA016557) Datasheet (External Link) |
| Vendor Page | Anti XPR1 pAb (ATL-HPA016557) |
| Citations for Anti XPR1 pAb (ATL-HPA016557) – 1 Found |
| Chen, Wei-Chao; Li, Qiu-Li; Pan, Qimei; Zhang, Hua-Yong; Fu, Xiao-Yan; Yao, Fan; Wang, Jian-Ning; Yang, An-Kui. Xenotropic and polytropic retrovirus receptor 1 (XPR1) promotes progression of tongue squamous cell carcinoma (TSCC) via activation of NF-κB signaling. Journal Of Experimental & Clinical Cancer Research : Cr. 2019;38(1):167. PubMed |