Anti XPR1 pAb (ATL-HPA016557)

Atlas Antibodies

Catalog No.:
ATL-HPA016557-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: xenotropic and polytropic retrovirus receptor 1
Gene Name: XPR1
Alternative Gene Name: SYG1, X3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026469: 99%, ENSRNOG00000000042: 97%
Entrez Gene ID: 9213
Uniprot ID: Q9UBH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT
Gene Sequence RFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEANT
Gene ID - Mouse ENSMUSG00000026469
Gene ID - Rat ENSRNOG00000000042
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XPR1 pAb (ATL-HPA016557)
Datasheet Anti XPR1 pAb (ATL-HPA016557) Datasheet (External Link)
Vendor Page Anti XPR1 pAb (ATL-HPA016557) at Atlas Antibodies

Documents & Links for Anti XPR1 pAb (ATL-HPA016557)
Datasheet Anti XPR1 pAb (ATL-HPA016557) Datasheet (External Link)
Vendor Page Anti XPR1 pAb (ATL-HPA016557)
Citations for Anti XPR1 pAb (ATL-HPA016557) – 1 Found
Chen, Wei-Chao; Li, Qiu-Li; Pan, Qimei; Zhang, Hua-Yong; Fu, Xiao-Yan; Yao, Fan; Wang, Jian-Ning; Yang, An-Kui. Xenotropic and polytropic retrovirus receptor 1 (XPR1) promotes progression of tongue squamous cell carcinoma (TSCC) via activation of NF-κB signaling. Journal Of Experimental & Clinical Cancer Research : Cr. 2019;38(1):167.  PubMed