Anti XPOT pAb (ATL-HPA057602)

Atlas Antibodies

SKU:
ATL-HPA057602-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exportin, tRNA
Gene Name: XPOT
Alternative Gene Name: XPO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034667: 95%, ENSRNOG00000007088: 95%
Entrez Gene ID: 11260
Uniprot ID: O43592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQP
Gene Sequence MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSELTTVQQQLIRETLISWLQAQMLNPQP
Gene ID - Mouse ENSMUSG00000034667
Gene ID - Rat ENSRNOG00000007088
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti XPOT pAb (ATL-HPA057602)
Datasheet Anti XPOT pAb (ATL-HPA057602) Datasheet (External Link)
Vendor Page Anti XPOT pAb (ATL-HPA057602) at Atlas Antibodies

Documents & Links for Anti XPOT pAb (ATL-HPA057602)
Datasheet Anti XPOT pAb (ATL-HPA057602) Datasheet (External Link)
Vendor Page Anti XPOT pAb (ATL-HPA057602)