Anti XPOT pAb (ATL-HPA048067)

Atlas Antibodies

Catalog No.:
ATL-HPA048067-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: exportin, tRNA
Gene Name: XPOT
Alternative Gene Name: XPO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034667: 97%, ENSRNOG00000007088: 88%
Entrez Gene ID: 11260
Uniprot ID: O43592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAY
Gene Sequence FDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAY
Gene ID - Mouse ENSMUSG00000034667
Gene ID - Rat ENSRNOG00000007088
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XPOT pAb (ATL-HPA048067)
Datasheet Anti XPOT pAb (ATL-HPA048067) Datasheet (External Link)
Vendor Page Anti XPOT pAb (ATL-HPA048067) at Atlas Antibodies

Documents & Links for Anti XPOT pAb (ATL-HPA048067)
Datasheet Anti XPOT pAb (ATL-HPA048067) Datasheet (External Link)
Vendor Page Anti XPOT pAb (ATL-HPA048067)