Anti XPOT pAb (ATL-HPA048067)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048067-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: XPOT
Alternative Gene Name: XPO3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034667: 97%, ENSRNOG00000007088: 88%
Entrez Gene ID: 11260
Uniprot ID: O43592
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAY |
Gene Sequence | FDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAY |
Gene ID - Mouse | ENSMUSG00000034667 |
Gene ID - Rat | ENSRNOG00000007088 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti XPOT pAb (ATL-HPA048067) | |
Datasheet | Anti XPOT pAb (ATL-HPA048067) Datasheet (External Link) |
Vendor Page | Anti XPOT pAb (ATL-HPA048067) at Atlas Antibodies |
Documents & Links for Anti XPOT pAb (ATL-HPA048067) | |
Datasheet | Anti XPOT pAb (ATL-HPA048067) Datasheet (External Link) |
Vendor Page | Anti XPOT pAb (ATL-HPA048067) |