Anti XPO4 pAb (ATL-HPA053768)

Atlas Antibodies

Catalog No.:
ATL-HPA053768-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: exportin 4
Gene Name: XPO4
Alternative Gene Name: FLJ13046, KIAA1721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021952: 98%, ENSRNOG00000010137: 98%
Entrez Gene ID: 64328
Uniprot ID: Q9C0E2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DIHWLILVTGYLLADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNRTDSVIRLLSAILRVSEVESRAIRADLTHLLSPQMG
Gene Sequence DIHWLILVTGYLLADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNRTDSVIRLLSAILRVSEVESRAIRADLTHLLSPQMG
Gene ID - Mouse ENSMUSG00000021952
Gene ID - Rat ENSRNOG00000010137
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XPO4 pAb (ATL-HPA053768)
Datasheet Anti XPO4 pAb (ATL-HPA053768) Datasheet (External Link)
Vendor Page Anti XPO4 pAb (ATL-HPA053768) at Atlas Antibodies

Documents & Links for Anti XPO4 pAb (ATL-HPA053768)
Datasheet Anti XPO4 pAb (ATL-HPA053768) Datasheet (External Link)
Vendor Page Anti XPO4 pAb (ATL-HPA053768)