Anti XPNPEP2 pAb (ATL-HPA064568)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064568-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: XPNPEP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037005: 63%, ENSRNOG00000004009: 67%
Entrez Gene ID: 7512
Uniprot ID: O43895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW |
Gene Sequence | VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW |
Gene ID - Mouse | ENSMUSG00000037005 |
Gene ID - Rat | ENSRNOG00000004009 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti XPNPEP2 pAb (ATL-HPA064568) | |
Datasheet | Anti XPNPEP2 pAb (ATL-HPA064568) Datasheet (External Link) |
Vendor Page | Anti XPNPEP2 pAb (ATL-HPA064568) at Atlas Antibodies |
Documents & Links for Anti XPNPEP2 pAb (ATL-HPA064568) | |
Datasheet | Anti XPNPEP2 pAb (ATL-HPA064568) Datasheet (External Link) |
Vendor Page | Anti XPNPEP2 pAb (ATL-HPA064568) |