Anti XPNPEP2 pAb (ATL-HPA064568)

Atlas Antibodies

Catalog No.:
ATL-HPA064568-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: X-prolyl aminopeptidase 2
Gene Name: XPNPEP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037005: 63%, ENSRNOG00000004009: 67%
Entrez Gene ID: 7512
Uniprot ID: O43895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW
Gene Sequence VGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTW
Gene ID - Mouse ENSMUSG00000037005
Gene ID - Rat ENSRNOG00000004009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XPNPEP2 pAb (ATL-HPA064568)
Datasheet Anti XPNPEP2 pAb (ATL-HPA064568) Datasheet (External Link)
Vendor Page Anti XPNPEP2 pAb (ATL-HPA064568) at Atlas Antibodies

Documents & Links for Anti XPNPEP2 pAb (ATL-HPA064568)
Datasheet Anti XPNPEP2 pAb (ATL-HPA064568) Datasheet (External Link)
Vendor Page Anti XPNPEP2 pAb (ATL-HPA064568)