Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000339-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: XPNPEP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037005: 77%, ENSRNOG00000004009: 75%
Entrez Gene ID: 7512
Uniprot ID: O43895
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI |
| Gene Sequence | VRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGI |
| Gene ID - Mouse | ENSMUSG00000037005 |
| Gene ID - Rat | ENSRNOG00000004009 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) | |
| Datasheet | Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) | |
| Datasheet | Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) |
| Citations for Anti XPNPEP2 pAb (ATL-HPA000339 w/enhanced validation) – 1 Found |
| Lindgren, David; Boström, Anna-Karin; Nilsson, Kristina; Hansson, Jennifer; Sjölund, Jonas; Möller, Christina; Jirström, Karin; Nilsson, Elise; Landberg, Göran; Axelson, Håkan; Johansson, Martin E. Isolation and characterization of progenitor-like cells from human renal proximal tubules. The American Journal Of Pathology. 2011;178(2):828-37. PubMed |