Anti XKR6 pAb (ATL-HPA064769)

Atlas Antibodies

Catalog No.:
ATL-HPA064769-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: XK related 6
Gene Name: XKR6
Alternative Gene Name: C8orf21, C8orf5, C8orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035067: 100%, ENSRNOG00000011634: 100%
Entrez Gene ID: 286046
Uniprot ID: Q5GH73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Gene Sequence FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL
Gene ID - Mouse ENSMUSG00000035067
Gene ID - Rat ENSRNOG00000011634
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XKR6 pAb (ATL-HPA064769)
Datasheet Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link)
Vendor Page Anti XKR6 pAb (ATL-HPA064769) at Atlas Antibodies

Documents & Links for Anti XKR6 pAb (ATL-HPA064769)
Datasheet Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link)
Vendor Page Anti XKR6 pAb (ATL-HPA064769)