Anti XKR6 pAb (ATL-HPA064769)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064769-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: XKR6
Alternative Gene Name: C8orf21, C8orf5, C8orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035067: 100%, ENSRNOG00000011634: 100%
Entrez Gene ID: 286046
Uniprot ID: Q5GH73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL |
| Gene Sequence | FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL |
| Gene ID - Mouse | ENSMUSG00000035067 |
| Gene ID - Rat | ENSRNOG00000011634 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti XKR6 pAb (ATL-HPA064769) | |
| Datasheet | Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link) |
| Vendor Page | Anti XKR6 pAb (ATL-HPA064769) at Atlas Antibodies |
| Documents & Links for Anti XKR6 pAb (ATL-HPA064769) | |
| Datasheet | Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link) |
| Vendor Page | Anti XKR6 pAb (ATL-HPA064769) |