Anti XKR6 pAb (ATL-HPA064769)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064769-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: XKR6
Alternative Gene Name: C8orf21, C8orf5, C8orf7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035067: 100%, ENSRNOG00000011634: 100%
Entrez Gene ID: 286046
Uniprot ID: Q5GH73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL |
Gene Sequence | FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELLQYESSL |
Gene ID - Mouse | ENSMUSG00000035067 |
Gene ID - Rat | ENSRNOG00000011634 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti XKR6 pAb (ATL-HPA064769) | |
Datasheet | Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link) |
Vendor Page | Anti XKR6 pAb (ATL-HPA064769) at Atlas Antibodies |
Documents & Links for Anti XKR6 pAb (ATL-HPA064769) | |
Datasheet | Anti XKR6 pAb (ATL-HPA064769) Datasheet (External Link) |
Vendor Page | Anti XKR6 pAb (ATL-HPA064769) |