Anti XK pAb (ATL-HPA019036)

Atlas Antibodies

Catalog No.: ATL-HPA019036-25

Protein Description: X-linked Kx blood group
Gene Name: XK
Alternative Gene Name: Kx, NA, NAC, X1k, XKR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015342: 89%, ENSRNOG00000003749: 87%
Entrez Gene ID: 7504
Uniprot ID: P51811
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
• Gene Sequence: DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
• Gene ID - Mouse: ENSMUSG00000015342
• Gene ID - Rat: ENSRNOG00000003749
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti XK pAb (ATL-HPA019036) – 3 Found

Urata, Yuka; Nakamura, Masayuki; Sasaki, Natsuki; Shiokawa, Nari; Nishida, Yoshiaki; Arai, Kaoru; Hiwatashi, Hanae; Yokoyama, Izumi; Narumi, Shinsuke; Terayama, Yasuo; Murakami, Takenobu; Ugawa, Yoshikazu; Sakamoto, Hiroki; Kaneko, Satoshi; Nakazawa, Yusuke; Yamasaki, Ryo; Sadashima, Shoko; Sakai, Toshiaki; Arai, Hiroaki; Sano, Akira. Novel pathogenic XK mutations in McLeod syndrome and interaction between XK protein and chorein. Neurology. Genetics. 2019;5(3):e328. 

Park, Jae-Sook; Neiman, Aaron M. XK is a partner for VPS13A: a molecular link between Chorea-Acanthocytosis and McLeod Syndrome. Molecular Biology Of The Cell. 2020;31(22):2425-2436. 

Ryoden, Yuta; Segawa, Katsumori; Nagata, Shigekazu. Requirement of Xk and Vps13a for the P2X7-mediated phospholipid scrambling and cell lysis in mouse T cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2022;119(7)