Anti XIRP1 pAb (ATL-HPA016750 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA016750-25

Protein Description: xin actin-binding repeat containing 1
Gene Name: XIRP1
Alternative Gene Name: CMYA1, DKFZp451D042, Xin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079243: 76%, ENSRNOG00000037085: 73%
Entrez Gene ID: 165904
Uniprot ID: Q702N8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSCTWMFKPQPVDRPVGSREQHLQVSQVPAGERQTDRHVFETEPLQASGRPCGRRPVRYCSRVEIPSGQVSRQKEVFQALEAGKKEEQEPRVIAGSIPAGSVHKFT
• Gene Sequence: QSCTWMFKPQPVDRPVGSREQHLQVSQVPAGERQTDRHVFETEPLQASGRPCGRRPVRYCSRVEIPSGQVSRQKEVFQALEAGKKEEQEPRVIAGSIPAGSVHKFT
• Gene ID - Mouse: ENSMUSG00000079243
• Gene ID - Rat: ENSRNOG00000037085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti XIRP1 pAb (ATL-HPA016750 w/enhanced validation) – 1 Found

Holt, Ian; Fuller, Heidi R; Schindler, Roland F R; Shirran, Sally L; Brand, Thomas; Morris, Glenn E. An interaction of heart disease-associated proteins POPDC1/2 with XIRP1 in transverse tubules and intercalated discs. Bmc Molecular And Cell Biology. 2020;21(1):88.