Anti XDH pAb (ATL-HPA062641)

Atlas Antibodies

SKU:
ATL-HPA062641-25
  • Immunohistochemical staining of human lactating breast shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus & microtubule organizing center.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: xanthine dehydrogenase
Gene Name: XDH
Alternative Gene Name: XO, XOR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024066: 87%, ENSRNOG00000007081: 84%
Entrez Gene ID: 7498
Uniprot ID: P47989
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK
Gene Sequence GFVCFISADDVPGSNITGICNDETVFAKDKVTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDLKK
Gene ID - Mouse ENSMUSG00000024066
Gene ID - Rat ENSRNOG00000007081
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti XDH pAb (ATL-HPA062641)
Datasheet Anti XDH pAb (ATL-HPA062641) Datasheet (External Link)
Vendor Page Anti XDH pAb (ATL-HPA062641) at Atlas Antibodies

Documents & Links for Anti XDH pAb (ATL-HPA062641)
Datasheet Anti XDH pAb (ATL-HPA062641) Datasheet (External Link)
Vendor Page Anti XDH pAb (ATL-HPA062641)