Anti XCL1 pAb (ATL-HPA057725)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057725-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: XCL1
Alternative Gene Name: ATAC, LPTN, LTN, lymphotactin, SCM-1, SCM-1a, SCYC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026573: 53%, ENSRNOG00000002964: 40%
Entrez Gene ID: 6375
Uniprot ID: P47992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Gene Sequence | VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Gene ID - Mouse | ENSMUSG00000026573 |
Gene ID - Rat | ENSRNOG00000002964 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti XCL1 pAb (ATL-HPA057725) | |
Datasheet | Anti XCL1 pAb (ATL-HPA057725) Datasheet (External Link) |
Vendor Page | Anti XCL1 pAb (ATL-HPA057725) at Atlas Antibodies |
Documents & Links for Anti XCL1 pAb (ATL-HPA057725) | |
Datasheet | Anti XCL1 pAb (ATL-HPA057725) Datasheet (External Link) |
Vendor Page | Anti XCL1 pAb (ATL-HPA057725) |
Citations for Anti XCL1 pAb (ATL-HPA057725) – 1 Found |
Tamura, Ryo; Yoshihara, Kosuke; Nakaoka, Hirofumi; Yachida, Nozomi; Yamaguchi, Manako; Suda, Kazuaki; Ishiguro, Tatsuya; Nishino, Koji; Ichikawa, Hiroshi; Homma, Keiichi; Kikuchi, Akira; Ueda, Yutaka; Takei, Yuji; Fujiwara, Hiroyuki; Motoyama, Teiichi; Okuda, Shujiro; Wakai, Toshifumi; Inoue, Ituro; Enomoto, Takayuki. XCL1 expression correlates with CD8-positive T cells infiltration and PD-L1 expression in squamous cell carcinoma arising from mature cystic teratoma of the ovary. Oncogene. 2020;39(17):3541-3554. PubMed |