Anti XCL1 pAb (ATL-HPA057725)

Atlas Antibodies

Catalog No.:
ATL-HPA057725-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: chemokine (C motif) ligand 1
Gene Name: XCL1
Alternative Gene Name: ATAC, LPTN, LTN, lymphotactin, SCM-1, SCM-1a, SCYC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026573: 53%, ENSRNOG00000002964: 40%
Entrez Gene ID: 6375
Uniprot ID: P47992
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Gene Sequence VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Gene ID - Mouse ENSMUSG00000026573
Gene ID - Rat ENSRNOG00000002964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XCL1 pAb (ATL-HPA057725)
Datasheet Anti XCL1 pAb (ATL-HPA057725) Datasheet (External Link)
Vendor Page Anti XCL1 pAb (ATL-HPA057725) at Atlas Antibodies

Documents & Links for Anti XCL1 pAb (ATL-HPA057725)
Datasheet Anti XCL1 pAb (ATL-HPA057725) Datasheet (External Link)
Vendor Page Anti XCL1 pAb (ATL-HPA057725)
Citations for Anti XCL1 pAb (ATL-HPA057725) – 1 Found
Tamura, Ryo; Yoshihara, Kosuke; Nakaoka, Hirofumi; Yachida, Nozomi; Yamaguchi, Manako; Suda, Kazuaki; Ishiguro, Tatsuya; Nishino, Koji; Ichikawa, Hiroshi; Homma, Keiichi; Kikuchi, Akira; Ueda, Yutaka; Takei, Yuji; Fujiwara, Hiroyuki; Motoyama, Teiichi; Okuda, Shujiro; Wakai, Toshifumi; Inoue, Ituro; Enomoto, Takayuki. XCL1 expression correlates with CD8-positive T cells infiltration and PD-L1 expression in squamous cell carcinoma arising from mature cystic teratoma of the ovary. Oncogene. 2020;39(17):3541-3554.  PubMed