Anti XAF1 pAb (ATL-HPA057302)

Atlas Antibodies

Catalog No.:
ATL-HPA057302-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: XIAP associated factor 1
Gene Name: XAF1
Alternative Gene Name: BIRC4BP, HSXIAPAF1, XIAPAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040483: 48%, ENSRNOG00000037371: 50%
Entrez Gene ID: 54739
Uniprot ID: Q6GPH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC
Gene Sequence PVECKFCKLDMQLSKLELHESYCGSRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC
Gene ID - Mouse ENSMUSG00000040483
Gene ID - Rat ENSRNOG00000037371
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XAF1 pAb (ATL-HPA057302)
Datasheet Anti XAF1 pAb (ATL-HPA057302) Datasheet (External Link)
Vendor Page Anti XAF1 pAb (ATL-HPA057302) at Atlas Antibodies

Documents & Links for Anti XAF1 pAb (ATL-HPA057302)
Datasheet Anti XAF1 pAb (ATL-HPA057302) Datasheet (External Link)
Vendor Page Anti XAF1 pAb (ATL-HPA057302)
Citations for Anti XAF1 pAb (ATL-HPA057302) – 1 Found
Choo, Zhang'e; Koh, Rachel Yu Lin; Wallis, Karin; Koh, Timothy Jia Wei; Kuick, Chik Hong; Sobrado, Veronica; Kenchappa, Rajappa S; Loh, Amos Hong Pheng; Soh, Shui Yen; Schlisio, Susanne; Chang, Kenneth Tou En; Chen, Zhi Xiong. XAF1 promotes neuroblastoma tumor suppression and is required for KIF1Bβ-mediated apoptosis. Oncotarget. 2016;7(23):34229-39.  PubMed