Anti XAB2 pAb (ATL-HPA048751)

Atlas Antibodies

Catalog No.: ATL-HPA048751-25

Protein Description: XPA binding protein 2
Gene Name: XAB2
Alternative Gene Name: HCNP, HCRN, NTC90, SYF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019470: 100%, ENSRNOG00000000988: 100%
Entrez Gene ID: 56949
Uniprot ID: Q9HCS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLD
• Gene Sequence: RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLD
• Gene ID - Mouse: ENSMUSG00000019470
• Gene ID - Rat: ENSRNOG00000000988
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.