Anti XAB2 pAb (ATL-HPA048751)

Atlas Antibodies

Catalog No.:
ATL-HPA048751-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: XPA binding protein 2
Gene Name: XAB2
Alternative Gene Name: HCNP, HCRN, NTC90, SYF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019470: 100%, ENSRNOG00000000988: 100%
Entrez Gene ID: 56949
Uniprot ID: Q9HCS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLD
Gene Sequence RAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLD
Gene ID - Mouse ENSMUSG00000019470
Gene ID - Rat ENSRNOG00000000988
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti XAB2 pAb (ATL-HPA048751)
Datasheet Anti XAB2 pAb (ATL-HPA048751) Datasheet (External Link)
Vendor Page Anti XAB2 pAb (ATL-HPA048751) at Atlas Antibodies

Documents & Links for Anti XAB2 pAb (ATL-HPA048751)
Datasheet Anti XAB2 pAb (ATL-HPA048751) Datasheet (External Link)
Vendor Page Anti XAB2 pAb (ATL-HPA048751)