Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007415-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: WWTR1
Alternative Gene Name: DKFZp586I1419, TAZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027803: 96%, ENSRNOG00000016617: 96%
Entrez Gene ID: 25937
Uniprot ID: Q9GZV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST |
| Gene Sequence | MNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSST |
| Gene ID - Mouse | ENSMUSG00000027803 |
| Gene ID - Rat | ENSRNOG00000016617 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) | |
| Datasheet | Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) | |
| Datasheet | Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) |
| Citations for Anti WWTR1 pAb (ATL-HPA007415 w/enhanced validation) – 73 Found |
| Liu, Fei; Lagares, David; Choi, Kyoung Moo; Stopfer, Lauren; Marinković, Aleksandar; Vrbanac, Vladimir; Probst, Clemens K; Hiemer, Samantha E; Sisson, Thomas H; Horowitz, Jeffrey C; Rosas, Ivan O; Fredenburgh, Laura E; Feghali-Bostwick, Carol; Varelas, Xaralabos; Tager, Andrew M; Tschumperlin, Daniel J. Mechanosignaling through YAP and TAZ drives fibroblast activation and fibrosis. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2015;308(4):L344-57. PubMed |
| Di Agostino, Silvia; Sorrentino, Giovanni; Ingallina, Eleonora; Valenti, Fabio; Ferraiuolo, Maria; Bicciato, Silvio; Piazza, Silvano; Strano, Sabrina; Del Sal, Giannino; Blandino, Giovanni. YAP enhances the pro-proliferative transcriptional activity of mutant p53 proteins. Embo Reports. 2016;17(2):188-201. PubMed |
| Lodge, Emily J; Russell, John P; Patist, Amanda L; Francis-West, Philippa; Andoniadou, Cynthia L. Expression Analysis of the Hippo Cascade Indicates a Role in Pituitary Stem Cell Development. Frontiers In Physiology. 7( 27065882):114. PubMed |
| Feng, Xu; Liu, Peng; Zhou, Xin; Li, Meng-Tian; Li, Fu-Long; Wang, Zhen; Meng, Zhipeng; Sun, Yi-Ping; Yu, Ying; Xiong, Yue; Yuan, Hai-Xin; Guan, Kun-Liang. Thromboxane A2 Activates YAP/TAZ Protein to Induce Vascular Smooth Muscle Cell Proliferation and Migration. The Journal Of Biological Chemistry. 2016;291(36):18947-58. PubMed |
| Lo Sardo, Federica; Forcato, Mattia; Sacconi, Andrea; Capaci, Valeria; Zanconato, Francesca; Di Agostino, Silvia; Del Sal, Giannino; Pandolfi, Pier Paolo; Strano, Sabrina; Bicciato, Silvio; Blandino, Giovanni. MCM7 and its hosted miR-25, 93 and 106b cluster elicit YAP/TAZ oncogenic activity in lung cancer. Carcinogenesis. 2017;38(1):64-75. PubMed |
| Sorrentino, Giovanni; Ruggeri, Naomi; Zannini, Alessandro; Ingallina, Eleonora; Bertolio, Rebecca; Marotta, Carolina; Neri, Carmelo; Cappuzzello, Elisa; Forcato, Mattia; Rosato, Antonio; Mano, Miguel; Bicciato, Silvio; Del Sal, Giannino. Glucocorticoid receptor signalling activates YAP in breast cancer. Nature Communications. 2017;8( 28102225):14073. PubMed |
| Noguchi, Satoshi; Saito, Akira; Mikami, Yu; Urushiyama, Hirokazu; Horie, Masafumi; Matsuzaki, Hirotaka; Takeshima, Hideyuki; Makita, Kosuke; Miyashita, Naoya; Mitani, Akihisa; Jo, Taisuke; Yamauchi, Yasuhiro; Terasaki, Yasuhiro; Nagase, Takahide. TAZ contributes to pulmonary fibrosis by activating profibrotic functions of lung fibroblasts. Scientific Reports. 2017;7( 28195168):42595. PubMed |
| Wang, Zhen; Liu, Peng; Zhou, Xin; Wang, Tianxiang; Feng, Xu; Sun, Yi-Ping; Xiong, Yue; Yuan, Hai-Xin; Guan, Kun-Liang. Endothelin Promotes Colorectal Tumorigenesis by Activating YAP/TAZ. Cancer Research. 2017;77(9):2413-2423. PubMed |
| Liu, Chen-Ying; Yu, Tong; Huang, Yuji; Cui, Long; Hong, Wanjin. ETS (E26 transformation-specific) up-regulation of the transcriptional co-activator TAZ promotes cell migration and metastasis in prostate cancer. The Journal Of Biological Chemistry. 2017;292(22):9420-9430. PubMed |
| Diamantopoulou, Zoi; White, Gavin; Fadlullah, Muhammad Z H; Dreger, Marcel; Pickering, Karen; Maltas, Joe; Ashton, Garry; MacLeod, Ruth; Baillie, George S; Kouskoff, Valerie; Lacaud, Georges; Murray, Graeme I; Sansom, Owen J; Hurlstone, Adam F L; Malliri, Angeliki. TIAM1 Antagonizes TAZ/YAP Both in the Destruction Complex in the Cytoplasm and in the Nucleus to Inhibit Invasion of Intestinal Epithelial Cells. Cancer Cell. 2017;31(5):621-634.e6. PubMed |
| Deng, Yaqi; Wu, Lai Man Natalie; Bai, Shujun; Zhao, Chuntao; Wang, Haibo; Wang, Jincheng; Xu, Lingli; Sakabe, Masahide; Zhou, Wenhao; Xin, Mei; Lu, Q Richard. A reciprocal regulatory loop between TAZ/YAP and G-protein Gαs regulates Schwann cell proliferation and myelination. Nature Communications. 2017;8( 28443644):15161. PubMed |
| Sun, Congshan; De Mello, Vanessa; Mohamed, Abdalla; Ortuste Quiroga, Huascar P; Garcia-Munoz, Amaya; Al Bloshi, Abdullah; Tremblay, Annie M; von Kriegsheim, Alexander; Collie-Duguid, Elaina; Vargesson, Neil; Matallanas, David; Wackerhage, Henning; Zammit, Peter S. Common and Distinctive Functions of the Hippo Effectors Taz and Yap in Skeletal Muscle Stem Cell Function. Stem Cells (Dayton, Ohio). 2017;35(8):1958-1972. PubMed |
| Levasseur, Adrien; St-Jean, Guillaume; Paquet, Marilène; Boerboom, Derek; Boyer, Alexandre. Targeted Disruption of YAP and TAZ Impairs the Maintenance of the Adrenal Cortex. Endocrinology. 2017;158(11):3738-3753. PubMed |
| Mayoral-Varo, Víctor; Calcabrini, Annarica; Sánchez-Bailón, María Pilar; Martín-Pérez, Jorge. miR205 inhibits stem cell renewal in SUM159PT breast cancer cells. Plos One. 12(11):e0188637. PubMed |
| Ingallina, Eleonora; Sorrentino, Giovanni; Bertolio, Rebecca; Lisek, Kamil; Zannini, Alessandro; Azzolin, Luca; Severino, Luisa Ulloa; Scaini, Denis; Mano, Miguel; Mantovani, Fiamma; Rosato, Antonio; Bicciato, Silvio; Piccolo, Stefano; Del Sal, Giannino. Mechanical cues control mutant p53 stability through a mevalonate-RhoA axis. Nature Cell Biology. 2018;20(1):28-35. PubMed |
| Hagiyama, Man; Yabuta, Norikazu; Okuzaki, Daisuke; Inoue, Takao; Takashima, Yasutoshi; Kimura, Ryuichiro; Ri, Aritoshi; Ito, Akihiko. Modest Static Pressure Suppresses Columnar Epithelial Cell Growth in Association with Cell Shape and Cytoskeletal Modifications. Frontiers In Physiology. 8( 29259558):997. PubMed |
| Konishi, Takanori; Schuster, Rebecca M; Lentsch, Alex B. Proliferation of hepatic stellate cells, mediated by YAP and TAZ, contributes to liver repair and regeneration after liver ischemia-reperfusion injury. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2018;314(4):G471-G482. PubMed |
| Jeong, Sun-Hye; Kim, Han-Byul; Kim, Min-Chul; Lee, Ji-Min; Lee, Jae Ho; Kim, Jeong-Hwan; Kim, Jin-Woo; Park, Woong-Yang; Kim, Seon-Young; Kim, Jae Bum; Kim, Haeryoung; Kim, Jin-Man; Choi, Hueng-Sik; Lim, Dae-Sik. Hippo-mediated suppression of IRS2/AKT signaling prevents hepatic steatosis and liver cancer. The Journal Of Clinical Investigation. 2018;128(3):1010-1025. PubMed |
| Deel, Michael D; Slemmons, Katherine K; Hinson, Ashley R; Genadry, Katia C; Burgess, Breanne A; Crose, Lisa E S; Kuprasertkul, Nina; Oristian, Kristianne M; Bentley, Rex C; Linardic, Corinne M. The Transcriptional Coactivator TAZ Is a Potent Mediator of Alveolar Rhabdomyosarcoma Tumorigenesis. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2018;24(11):2616-2630. PubMed |
| Kato, Katsuhiro; Diéguez-Hurtado, Rodrigo; Park, Do Young; Hong, Seon Pyo; Kato-Azuma, Sakiko; Adams, Susanne; Stehling, Martin; Trappmann, Britta; Wrana, Jeffrey L; Koh, Gou Young; Adams, Ralf H. Pulmonary pericytes regulate lung morphogenesis. Nature Communications. 2018;9(1):2448. PubMed |
| Han, Han; Yang, Bing; Nakaoka, Hiroki J; Yang, Jiadong; Zhao, Yifan; Le Nguyen, Kathern; Bishara, Amell Taffy; Mandalia, Tejas Krishen; Wang, Wenqi. Hippo signaling dysfunction induces cancer cell addiction to YAP. Oncogene. 2018;37(50):6414-6424. PubMed |
| Xekouki, Paraskevi; Lodge, Emily J; Matschke, Jakob; Santambrogio, Alice; Apps, John R; Sharif, Ariane; Jacques, Thomas S; Aylwin, Simon; Prevot, Vincent; Li, Ran; Flitsch, Jörg; Bornstein, Stefan R; Theodoropoulou, Marily; Andoniadou, Cynthia L. Non-secreting pituitary tumours characterised by enhanced expression of YAP/TAZ. Endocrine-Related Cancer. 2019;26(1):215-225. PubMed |
| Merritt, Nicole M; Fullenkamp, Colleen A; Hall, Sarah L; Qian, Qining; Desai, Chandni; Thomason, Jon; Lambertz, Allyn M; Dupuy, Adam J; Darbro, Benjamin; Tanas, Munir R. A comprehensive evaluation of Hippo pathway silencing in sarcomas. Oncotarget. 2018;9(60):31620-31636. PubMed |
| Eales, Katherine L; Wilkinson, Edward A; Cruickshank, Garth; Tucker, James H R; Tennant, Daniel A. Verteporfin selectively kills hypoxic glioma cells through iron-binding and increased production of reactive oxygen species. Scientific Reports. 2018;8(1):14358. PubMed |
| Mohamed, Abdalla D; Shah, Nupur; Hettmer, Simone; Vargesson, Neil; Wackerhage, Henning. Analysis of the relationship between the KRAS G12V oncogene and the Hippo effector YAP1 in embryonal rhabdomyosarcoma. Scientific Reports. 2018;8(1):15674. PubMed |
| Lu, Yuxiong; Maruyama, Junichi; Kuwata, Keiko; Fukuda, Hiroyuki; Iwasa, Hiroaki; Arimoto-Matsuzaki, Kyoko; Sugimura, Haruhiko; Hata, Yutaka. Doublecortin-like kinase 1 compromises DNA repair and induces chromosomal instability. Biochemistry And Biophysics Reports. 2018;16( 30417131):130-137. PubMed |
| Li, Nianshuang; Feng, Yan; Hu, Yi; He, Cong; Xie, Chuan; Ouyang, Yaobin; Artim, Stephen C; Huang, Deqiang; Zhu, Yin; Luo, Zhijun; Ge, Zhongming; Lu, Nonghua. Helicobacter pylori CagA promotes epithelial mesenchymal transition in gastric carcinogenesis via triggering oncogenic YAP pathway. Journal Of Experimental & Clinical Cancer Research : Cr. 2018;37(1):280. PubMed |
| Luu, Anita K; Schott, Courtney R; Jones, Robert; Poon, Andrew C; Golding, Brandon; Hamed, Roa'a; Deheshi, Benjamin; Mutsaers, Anthony; Wood, Geoffrey A; Viloria-Petit, Alicia M. An evaluation of TAZ and YAP crosstalk with TGFβ signalling in canine osteosarcoma suggests involvement of hippo signalling in disease progression. Bmc Veterinary Research. 2018;14(1):365. PubMed |
| LeBlanc, Lucy; Lee, Bum-Kyu; Yu, Andy C; Kim, Mijeong; Kambhampati, Aparna V; Dupont, Shannon M; Seruggia, Davide; Ryu, Byoung U; Orkin, Stuart H; Kim, Jonghwan. Yap1 safeguards mouse embryonic stem cells from excessive apoptosis during differentiation. Elife. 2018;7( 30561326) PubMed |
| Hwang, Jun-Ha; Kim, A Rum; Kim, Kyung Min; Il Park, Jung; Oh, Ho Taek; Moon, Sung A; Byun, Mi Ran; Jeong, Hana; Kim, Hyo Kyung; Yaffe, Michael B; Hwang, Eun Sook; Hong, Jeong-Ho. TAZ couples Hippo/Wnt signalling and insulin sensitivity through Irs1 expression. Nature Communications. 2019;10(1):421. PubMed |
| Kim, Yoo Hyung; Choi, Jeongwoon; Yang, Myung Jin; Hong, Seon Pyo; Lee, Choong-Kun; Kubota, Yoshiaki; Lim, Dae-Sik; Koh, Gou Young. A MST1-FOXO1 cascade establishes endothelial tip cell polarity and facilitates sprouting angiogenesis. Nature Communications. 2019;10(1):838. PubMed |
| Lodge, Emily J; Santambrogio, Alice; Russell, John P; Xekouki, Paraskevi; Jacques, Thomas S; Johnson, Randy L; Thavaraj, Selvam; Bornstein, Stefan R; Andoniadou, Cynthia Lilian. Homeostatic and tumourigenic activity of SOX2+ pituitary stem cells is controlled by the LATS/YAP/TAZ cascade. Elife. 2019;8( 30912742) PubMed |
| Sun, Tianhe; Huang, Zhiyu; Zhang, Hua; Posner, Clara; Jia, Guiquan; Ramalingam, Thirumalai R; Xu, Min; Brightbill, Hans; Egen, Jackson G; Dey, Anwesha; Arron, Joseph R. TAZ is required for lung alveolar epithelial cell differentiation after injury. Jci Insight. 2019;5(14) PubMed |
| Canu, Valeria; Donzelli, Sara; Sacconi, Andrea; Lo Sardo, Federica; Pulito, Claudio; Bossel, Noa; Di Benedetto, Anna; Muti, Paola; Botti, Claudio; Domany, Eytan; Bicciato, Silvio; Strano, Sabrina; Yarden, Yosef; Blandino, Giovanni. Aberrant transcriptional and post-transcriptional regulation of SPAG5, a YAP-TAZ-TEAD downstream effector, fuels breast cancer cell proliferation. Cell Death And Differentiation. 2021;28(5):1493-1511. PubMed |
| Barthet, Valentin J A; Brucoli, Martina; Ladds, Marcus J G W; Nössing, Christoph; Kiourtis, Christos; Baudot, Alice D; O'Prey, James; Zunino, Barbara; Müller, Miryam; May, Stephanie; Nixon, Colin; Long, Jaclyn S; Bird, Thomas G; Ryan, Kevin M. Autophagy suppresses the formation of hepatocyte-derived cancer-initiating ductular progenitor cells in the liver. Science Advances. 2021;7(23) PubMed |
| Mygland, Line; Brinch, Shoshy Alam; Strand, Martin Frank; Olsen, Petter Angell; Aizenshtadt, Aleksandra; Lund, Kaja; Solberg, Nina Therese; Lycke, Max; Thorvaldsen, Tor Espen; Espada, Sandra; Misaghian, Dorna; Page, Christian M; Agafonov, Oleg; Nygård, Ståle; Chi, Nai-Wen; Lin, Eva; Tan, Jenille; Yu, Yihong; Costa, Mike; Krauss, Stefan; Waaler, Jo. Identification of response signatures for tankyrase inhibitor treatment in tumor cell lines. Iscience. 2021;24(7):102807. PubMed |
| Jeon, Hae Yon; Choi, Jinwook; Kraaier, Lianne; Kim, Young Hoon; Eisenbarth, David; Yi, Kijong; Kang, Ju-Gyeong; Kim, Jin Woo; Shim, Hyo Sup; Lee, Joo-Hyeon; Lim, Dae-Sik. Airway secretory cell fate conversion via YAP-mTORC1-dependent essential amino acid metabolism. The Embo Journal. 2022;41(8):e109365. PubMed |
| Ong, Yu Ting; Andrade, Jorge; Armbruster, Max; Shi, Chenyue; Castro, Marco; Costa, Ana S H; Sugino, Toshiya; Eelen, Guy; Zimmermann, Barbara; Wilhelm, Kerstin; Lim, Joseph; Watanabe, Shuichi; Guenther, Stefan; Schneider, Andre; Zanconato, Francesca; Kaulich, Manuel; Pan, Duojia; Braun, Thomas; Gerhardt, Holger; Efeyan, Alejo; Carmeliet, Peter; Piccolo, Stefano; Grosso, Ana Rita; Potente, Michael. A YAP/TAZ-TEAD signalling module links endothelial nutrient acquisition to angiogenic growth. Nature Metabolism. 2022;4(6):672-682. PubMed |
| Sorrentino, Giovanni; Ruggeri, Naomi; Specchia, Valeria; Cordenonsi, Michelangelo; Mano, Miguel; Dupont, Sirio; Manfrin, Andrea; Ingallina, Eleonora; Sommaggio, Roberta; Piazza, Silvano; Rosato, Antonio; Piccolo, Stefano; Del Sal, Giannino. Metabolic control of YAP and TAZ by the mevalonate pathway. Nature Cell Biology. 2014;16(4):357-66. PubMed |
| Slemmons, Katherine K; Crose, Lisa E S; Rudzinski, Erin; Bentley, Rex C; Linardic, Corinne M. Role of the YAP Oncoprotein in Priming Ras-Driven Rhabdomyosarcoma. Plos One. 10(10):e0140781. PubMed |
| Fullenkamp, Colleen A; Hall, Sarah L; Jaber, Omar I; Pakalniskis, Brittany L; Savage, Erica C; Savage, Johanna M; Ofori-Amanfo, Georgina K; Lambertz, Allyn M; Ivins, Stephanie D; Stipp, Christopher S; Miller, Benjamin J; Milhem, Mohammed M; Tanas, Munir R. TAZ and YAP are frequently activated oncoproteins in sarcomas. Oncotarget. 2016;7(21):30094-108. PubMed |
| Mohamed, Abdalla; Sun, Congshan; De Mello, Vanessa; Selfe, Joanna; Missiaglia, Edoardo; Shipley, Janet; Murray, Graeme I; Zammit, Pete S; Wackerhage, Henning. The Hippo effector TAZ (WWTR1) transforms myoblasts and TAZ abundance is associated with reduced survival in embryonal rhabdomyosarcoma. The Journal Of Pathology. 2016;240(1):3-14. PubMed |
| Gruber, Ralph; Panayiotou, Richard; Nye, Emma; Spencer-Dene, Bradley; Stamp, Gordon; Behrens, Axel. YAP1 and TAZ Control Pancreatic Cancer Initiation in Mice by Direct Up-regulation of JAK-STAT3 Signaling. Gastroenterology. 2016;151(3):526-39. PubMed |
| Hu, Jimmy Kuang-Hsien; Du, Wei; Shelton, Samuel J; Oldham, Michael C; DiPersio, C Michael; Klein, Ophir D. An FAK-YAP-mTOR Signaling Axis Regulates Stem Cell-Based Tissue Renewal in Mice. Cell Stem Cell. 2017;21(1):91-106.e6. PubMed |
| Neto, Filipa; Klaus-Bergmann, Alexandra; Ong, Yu Ting; Alt, Silvanus; Vion, Anne-Clémence; Szymborska, Anna; Carvalho, Joana R; Hollfinger, Irene; Bartels-Klein, Eireen; Franco, Claudio A; Potente, Michael; Gerhardt, Holger. YAP and TAZ regulate adherens junction dynamics and endothelial cell distribution during vascular development. Elife. 2018;7( 29400648) PubMed |
| Zanconato, Francesca; Battilana, Giusy; Forcato, Mattia; Filippi, Letizia; Azzolin, Luca; Manfrin, Andrea; Quaranta, Erika; Di Biagio, Daniele; Sigismondo, Gianluca; Guzzardo, Vincenza; Lejeune, Pascale; Haendler, Bernard; Krijgsveld, Jeroen; Fassan, Matteo; Bicciato, Silvio; Cordenonsi, Michelangelo; Piccolo, Stefano. Transcriptional addiction in cancer cells is mediated by YAP/TAZ through BRD4. Nature Medicine. 2018;24(10):1599-1610. PubMed |
| Kingston, Nathan M; Tilston-Lunel, Andrew M; Hicks-Berthet, Julia; Varelas, Xaralabos. Immunofluorescence Microscopy to Study Endogenous TAZ in Mammalian Cells. Methods In Molecular Biology (Clifton, N.j.). 1893( 30565129):107-113. PubMed |
| Volckaert, Thomas; Yuan, Tingting; Yuan, Jie; Boateng, Eistine; Hopkins, Seantel; Zhang, Jin-San; Thannickal, Victor J; Fässler, Reinhard; De Langhe, Stijn P. Hippo signaling promotes lung epithelial lineage commitment by curbing Fgf10 and β-catenin signaling. Development (Cambridge, England). 2019;146(2) PubMed |
| Crespo-Enriquez, Ivan; Hodgson, Tina; Zakaria, Sana; Cadoni, Erika; Shah, Mittal; Allen, Stephen; Al-Khishali, Ayman; Mao, Yaopan; Yiu, Angela; Petzold, Jonna; Villagomez-Olea, Guillermo; Pitsillides, Andrew A; Irvine, Kenneth D; Francis-West, Philippa. Dchs1-Fat4 regulation of osteogenic differentiation in mouse. Development (Cambridge, England). 2019;146(14) PubMed |
| Asahina, Kinji; Balog, Steven; Hwang, Edward; Moon, Eugene; Wan, Emily; Skrypek, Kaitlin; Chen, Yibu; Fernandez, Jay; Romo, Janet; Yang, Qihong; Lai, Keane; French, Samuel W; Tsukamoto, Hidekazu. Moderate alcohol intake promotes pancreatic ductal adenocarcinoma development in mice expressing oncogenic Kras. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2020;318(2):G265-G276. PubMed |
| Isfort, Ilka; Elges, Sandra; Cyra, Magdalene; Berthold, Ruth; Renner, Marcus; Mechtersheimer, Gunhild; Åman, Pierre; Larsson, Olle; Ratner, Nancy; Hafner, Susanne; Simmet, Thomas; Schliemann, Christoph; Rossig, Claudia; Dirksen, Uta; Grünewald, Inga; Wardelmann, Eva; Huss, Sebastian; Hartmann, Wolfgang; Trautmann, Marcel. Prevalence of the Hippo Effectors YAP1/TAZ in Tumors of Soft Tissue and Bone. Scientific Reports. 2019;9(1):19704. PubMed |
| Escoll, Maribel; Lastra, Diego; Pajares, Marta; Robledinos-Antón, Natalia; Rojo, Ana I; Fernández-Ginés, Raquel; Mendiola, Marta; Martínez-Marín, Virginia; Esteban, Isabel; López-Larrubia, Pilar; Gargini, Ricardo; Cuadrado, Antonio. Transcription factor NRF2 uses the Hippo pathway effector TAZ to induce tumorigenesis in glioblastomas. Redox Biology. 2020;30( 31918259):101425. PubMed |
| Sivaraj, Kishor K; Dharmalingam, Backialakshmi; Mohanakrishnan, Vishal; Jeong, Hyun-Woo; Kato, Katsuhiro; Schröder, Silke; Adams, Susanne; Koh, Gou Young; Adams, Ralf H. YAP1 and TAZ negatively control bone angiogenesis by limiting hypoxia-inducible factor signaling in endothelial cells. Elife. 2020;9( 31958058) PubMed |
| Choi, Sung Yong; Bae, Hosung; Jeong, Sun-Hye; Park, Intae; Cho, Hyunsoo; Hong, Seon Pyo; Lee, Da-Hye; Lee, Choong-Kun; Park, Jin-Sung; Suh, Sang Heon; Choi, Jeongwoon; Yang, Myung Jin; Jang, Jeon Yeob; Onder, Lucas; Moon, Jeong Hwan; Jeong, Han-Sin; Adams, Ralf H; Kim, Jin-Man; Ludewig, Burkhard; Song, Joo-Hye; Lim, Dae-Sik; Koh, Gou Young. YAP/TAZ direct commitment and maturation of lymph node fibroblastic reticular cells. Nature Communications. 2020;11(1):519. PubMed |
| Panciera, Tito; Citron, Anna; Di Biagio, Daniele; Battilana, Giusy; Gandin, Alessandro; Giulitti, Stefano; Forcato, Mattia; Bicciato, Silvio; Panzetta, Valeria; Fusco, Sabato; Azzolin, Luca; Totaro, Antonio; Dei Tos, Angelo Paolo; Fassan, Matteo; Vindigni, Vincenzo; Bassetto, Franco; Rosato, Antonio; Brusatin, Giovanna; Cordenonsi, Michelangelo; Piccolo, Stefano. Reprogramming normal cells into tumour precursors requires ECM stiffness and oncogene-mediated changes of cell mechanical properties. Nature Materials. 2020;19(7):797-806. PubMed |
| Kimura, Masahiro; Horie, Takahiro; Baba, Osamu; Ide, Yuya; Tsuji, Shuhei; Ruiz Rodriguez, Randolph; Watanabe, Toshimitsu; Yamasaki, Tomohiro; Otani, Chiharu; Xu, Sijia; Miyasaka, Yui; Nakashima, Yasuhiro; Kimura, Takeshi; Ono, Koh. Homeobox A4 suppresses vascular remodeling by repressing YAP/TEAD transcriptional activity. Embo Reports. 2020;21(4):e48389. PubMed |
| Tiffon, Camille; Giraud, Julie; Molina-Castro, Silvia Elena; Peru, Sara; Seeneevassen, Lornella; Sifré, Elodie; Staedel, Cathy; Bessède, Emilie; Dubus, Pierre; Mégraud, Francis; Lehours, Philippe; Martin, Océane C B; Varon, Christine. TAZ Controls Helicobacter pylori-Induced Epithelial-Mesenchymal Transition and Cancer Stem Cell-Like Invasive and Tumorigenic Properties. Cells. 2020;9(6) PubMed |
| Chai, Tin Fan; Manu, Kanjoormana Aryan; Casey, Patrick J; Wang, Mei. Isoprenylcysteine carboxylmethyltransferase is required for the impact of mutant KRAS on TAZ protein level and cancer cell self-renewal. Oncogene. 2020;39(31):5373-5389. PubMed |
| Kierulf-Vieira, Kirsten Strømme; Sandberg, Cecilie Jonsgar; Waaler, Jo; Lund, Kaja; Skaga, Erlend; Saberniak, Birthe Mikkelsen; Panagopoulos, Ioannis; Brandal, Petter; Krauss, Stefan; Langmoen, Iver Arne; Vik-Mo, Einar Osland. A Small-Molecule Tankyrase Inhibitor Reduces Glioma Stem Cell Proliferation and Sphere Formation. Cancers. 2020;12(6) PubMed |
| Aragona, Mariaceleste; Sifrim, Alejandro; Malfait, Milan; Song, Yura; Van Herck, Jens; Dekoninck, Sophie; Gargouri, Souhir; Lapouge, Gaëlle; Swedlund, Benjamin; Dubois, Christine; Baatsen, Pieter; Vints, Katlijn; Han, Seungmin; Tissir, Fadel; Voet, Thierry; Simons, Benjamin D; Blanpain, Cédric. Mechanisms of stretch-mediated skin expansion at single-cell resolution. Nature. 2020;584(7820):268-273. PubMed |
| Hong, Seon Pyo; Yang, Myung Jin; Cho, Hyunsoo; Park, Intae; Bae, Hosung; Choe, Kibaek; Suh, Sang Heon; Adams, Ralf H; Alitalo, Kari; Lim, Daesik; Koh, Gou Young. Distinct fibroblast subsets regulate lacteal integrity through YAP/TAZ-induced VEGF-C in intestinal villi. Nature Communications. 2020;11(1):4102. PubMed |
| Vanyai, Hannah K; Prin, Fabrice; Guillermin, Oriane; Marzook, Bishara; Boeing, Stefan; Howson, Alexander; Saunders, Rebecca E; Snoeks, Thomas; Howell, Michael; Mohun, Timothy J; Thompson, Barry. Control of skeletal morphogenesis by the Hippo-YAP/TAZ pathway. Development (Cambridge, England). 2020;147(21) PubMed |
| Robledinos-Antón, Natalia; Escoll, Maribel; Guan, Kun-Liang; Cuadrado, Antonio. TAZ Represses the Neuronal Commitment of Neural Stem Cells. Cells. 2020;9(10) PubMed |
| Cha, Boksik; Ho, Yen-Chun; Geng, Xin; Mahamud, Md Riaj; Chen, Lijuan; Kim, Yeunhee; Choi, Dongwon; Kim, Tae Hoon; Randolph, Gwendalyn J; Cao, Xinwei; Chen, Hong; Srinivasan, R Sathish. YAP and TAZ maintain PROX1 expression in the developing lymphatic and lymphovenous valves in response to VEGF-C signaling. Development (Cambridge, England). 2020;147(23) PubMed |
| Kronenberg, Nils M; Tilston-Lunel, Andrew; Thompson, Frances E; Chen, Doris; Yu, Wanjia; Dholakia, Kishan; Gather, Malte C; Gunn-Moore, Frank J. Willin/FRMD6 Influences Mechanical Phenotype and Neuronal Differentiation in Mammalian Cells by Regulating ERK1/2 Activity. Frontiers In Cellular Neuroscience. 14( 33088261):552213. PubMed |
| Wang, Lei; Wang, ShengPeng; Shi, Yue; Li, Rui; Günther, Stefan; Ong, Yu Ting; Potente, Michael; Yuan, Zuyi; Liu, Enqi; Offermanns, Stefan. YAP and TAZ protect against white adipocyte cell death during obesity. Nature Communications. 2020;11(1):5455. PubMed |
| Uneda, Atsuhito; Kurozumi, Kazuhiko; Fujimura, Atsushi; Fujii, Kentaro; Ishida, Joji; Shimazu, Yosuke; Otani, Yoshihiro; Tomita, Yusuke; Hattori, Yasuhiko; Matsumoto, Yuji; Tsuboi, Nobushige; Makino, Keigo; Hirano, Shuichiro; Kamiya, Atsunori; Date, Isao. Differentiated glioblastoma cells accelerate tumor progression by shaping the tumor microenvironment via CCN1-mediated macrophage infiltration. Acta Neuropathologica Communications. 2021;9(1):29. PubMed |
| Della Chiara, Giulia; Gervasoni, Federica; Fakiola, Michaela; Godano, Chiara; D'Oria, Claudia; Azzolin, Luca; Bonnal, Raoul Jean Pierre; Moreni, Giulia; Drufuca, Lorenzo; Rossetti, Grazisa; Ranzani, Valeria; Bason, Ramona; De Simone, Marco; Panariello, Francesco; Ferrari, Ivan; Fabbris, Tanya; Zanconato, Francesca; Forcato, Mattia; Romano, Oriana; Caroli, Jimmy; Gruarin, Paola; Sarnicola, Maria Lucia; Cordenonsi, Michelangelo; Bardelli, Alberto; Zucchini, Nicola; Ceretti, Andrea Pisani; Mariani, Nicolò Maria; Cassingena, Andrea; Sartore-Bianchi, Andrea; Testa, Giuseppe; Gianotti, Luca; Opocher, Enrico; Pisati, Federica; Tripodo, Claudio; Macino, Giuseppe; Siena, Salvatore; Bicciato, Silvio; Piccolo, Stefano; Pagani, Massimiliano. Epigenomic landscape of human colorectal cancer unveils an aberrant core of pan-cancer enhancers orchestrated by YAP/TAZ. Nature Communications. 2021;12(1):2340. PubMed |
| Desai, Chandni; Thomason, Jon; Kohlmeyer, Jordan L; Reisetter, Anna C; Ahirwar, Parmanand; Jahanseir, Khadijeh; Leidinger, Mariah; Ofori-Amanfo, Georgina; Fritchie, Karen; Velu, Sadanandan E; Breheny, Patrick; Quelle, Dawn E; Tanas, Munir R. Prognostic and therapeutic value of the Hippo pathway, RABL6A, and p53-MDM2 axes in sarcomas. Oncotarget. 2021;12(8):740-755. PubMed |
| Nakamura, Ryosuke; Bing, Renjie; Doyle, Carina P; Garabedian, Michael J; Branski, Ryan C. Glucocorticoids activate Yes-associated protein in human vocal fold fibroblasts. Experimental Cell Research. 2021;405(2):112681. PubMed |
| Bae, Jung Hyun; Yang, Myung Jin; Jeong, Seung-Hwan; Kim, JungMo; Hong, Seon Pyo; Kim, Jin Woo; Kim, Yoo Hyung; Koh, Gou Young. Gatekeeping role of Nf2/Merlin in vascular tip EC induction through suppression of VEGFR2 internalization. Science Advances. 2022;8(23):eabn2611. PubMed |
| Kovach, Alexander R; Oristian, Kristianne M; Kirsch, David G; Bentley, Rex C; Cheng, Changde; Chen, Xiang; Chen, Po-Han; Chi, Jen-Tsan Ashley; Linardic, Corinne M. Identification and targeting of a HES1-YAP1-CDKN1C functional interaction in fusion-negative rhabdomyosarcoma. Molecular Oncology. 2022;16(20):3587-3605. PubMed |
| Castellan, Martina; Guarnieri, Alberto; Fujimura, Atsushi; Zanconato, Francesca; Battilana, Giusy; Panciera, Tito; Sladitschek, Hanna Lucie; Contessotto, Paolo; Citron, Anna; Grilli, Andrea; Romano, Oriana; Bicciato, Silvio; Fassan, Matteo; Porcù, Elena; Rosato, Antonio; Cordenonsi, Michelangelo; Piccolo, Stefano. Single-cell analyses reveal YAP/TAZ as regulators of stemness and cell plasticity in Glioblastoma. Nature Cancer. 2021;2(2):174-188. PubMed |