Anti WWOX pAb (ATL-HPA050992)

Atlas Antibodies

Catalog No.: ATL-HPA050992-25

Protein Description: WW domain containing oxidoreductase
Gene Name: WWOX
Alternative Gene Name: FOR, SDR41C1, WOX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004637: 100%, ENSRNOG00000012030: 100%
Entrez Gene ID: 51741
Uniprot ID: Q9NZC7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS
• Gene Sequence: VYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGS
• Gene ID - Mouse: ENSMUSG00000004637
• Gene ID - Rat: ENSRNOG00000012030
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WWOX pAb (ATL-HPA050992) – 1 Found

Tochigi, Yuki; Takamatsu, Yutaka; Nakane, Jun; Nakai, Rika; Katayama, Kentaro; Suzuki, Hiroetsu. Loss of Wwox Causes Defective Development of Cerebral Cortex with Hypomyelination in a Rat Model of Lethal Dwarfism with Epilepsy. International Journal Of Molecular Sciences. 2019;20(14)