Anti WSB2 pAb (ATL-HPA052606)

Atlas Antibodies

Catalog No.:
ATL-HPA052606-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: WD repeat and SOCS box containing 2
Gene Name: WSB2
Alternative Gene Name: MGC10210, SBA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029364: 92%, ENSRNOG00000001135: 89%
Entrez Gene ID: 55884
Uniprot ID: Q9NYS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLL
Gene Sequence LVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLL
Gene ID - Mouse ENSMUSG00000029364
Gene ID - Rat ENSRNOG00000001135
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WSB2 pAb (ATL-HPA052606)
Datasheet Anti WSB2 pAb (ATL-HPA052606) Datasheet (External Link)
Vendor Page Anti WSB2 pAb (ATL-HPA052606) at Atlas Antibodies

Documents & Links for Anti WSB2 pAb (ATL-HPA052606)
Datasheet Anti WSB2 pAb (ATL-HPA052606) Datasheet (External Link)
Vendor Page Anti WSB2 pAb (ATL-HPA052606)