Anti WSB2 pAb (ATL-HPA052606)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052606-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: WSB2
Alternative Gene Name: MGC10210, SBA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029364: 92%, ENSRNOG00000001135: 89%
Entrez Gene ID: 55884
Uniprot ID: Q9NYS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLL |
Gene Sequence | LVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLL |
Gene ID - Mouse | ENSMUSG00000029364 |
Gene ID - Rat | ENSRNOG00000001135 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WSB2 pAb (ATL-HPA052606) | |
Datasheet | Anti WSB2 pAb (ATL-HPA052606) Datasheet (External Link) |
Vendor Page | Anti WSB2 pAb (ATL-HPA052606) at Atlas Antibodies |
Documents & Links for Anti WSB2 pAb (ATL-HPA052606) | |
Datasheet | Anti WSB2 pAb (ATL-HPA052606) Datasheet (External Link) |
Vendor Page | Anti WSB2 pAb (ATL-HPA052606) |