Anti WRAP73 pAb (ATL-HPA026893)

Atlas Antibodies

Catalog No.: ATL-HPA026893-25

Protein Description: WD repeat containing, antisense to TP73
Gene Name: WRAP73
Alternative Gene Name: WDR8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029029: 83%, ENSRNOG00000014805: 53%
Entrez Gene ID: 49856
Uniprot ID: Q9P2S5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM
• Gene Sequence: SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM
• Gene ID - Mouse: ENSMUSG00000029029
• Gene ID - Rat: ENSRNOG00000014805
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.