Anti WNT6 pAb (ATL-HPA070759)

Atlas Antibodies

SKU:
ATL-HPA070759-25
  • Immunohistochemical staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Wnt family member 6
Gene Name: WNT6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033227: 98%, ENSRNOG00000017409: 98%
Entrez Gene ID: 7475
Uniprot ID: Q9Y6F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNE
Gene Sequence WEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNE
Gene ID - Mouse ENSMUSG00000033227
Gene ID - Rat ENSRNOG00000017409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WNT6 pAb (ATL-HPA070759)
Datasheet Anti WNT6 pAb (ATL-HPA070759) Datasheet (External Link)
Vendor Page Anti WNT6 pAb (ATL-HPA070759) at Atlas Antibodies

Documents & Links for Anti WNT6 pAb (ATL-HPA070759)
Datasheet Anti WNT6 pAb (ATL-HPA070759) Datasheet (External Link)
Vendor Page Anti WNT6 pAb (ATL-HPA070759)