Anti WNT10B pAb (ATL-HPA062539)

Atlas Antibodies

Catalog No.:
ATL-HPA062539-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: wingless-type MMTV integration site family, member 10B
Gene Name: WNT10B
Alternative Gene Name: SHFM6, WNT-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022996: 97%, ENSRNOG00000061238: 97%
Entrez Gene ID: 7480
Uniprot ID: O00744
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS
Gene Sequence SCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLRPRRLSGELVYFEKS
Gene ID - Mouse ENSMUSG00000022996
Gene ID - Rat ENSRNOG00000061238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WNT10B pAb (ATL-HPA062539)
Datasheet Anti WNT10B pAb (ATL-HPA062539) Datasheet (External Link)
Vendor Page Anti WNT10B pAb (ATL-HPA062539) at Atlas Antibodies

Documents & Links for Anti WNT10B pAb (ATL-HPA062539)
Datasheet Anti WNT10B pAb (ATL-HPA062539) Datasheet (External Link)
Vendor Page Anti WNT10B pAb (ATL-HPA062539)