Anti WNK3 pAb (ATL-HPA077678)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077678-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: WNK3
Alternative Gene Name: PRKWNK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041245: 59%, ENSRNOG00000002537: 41%
Entrez Gene ID: 65267
Uniprot ID: Q9BYP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV |
| Gene Sequence | SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV |
| Gene ID - Mouse | ENSMUSG00000041245 |
| Gene ID - Rat | ENSRNOG00000002537 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WNK3 pAb (ATL-HPA077678) | |
| Datasheet | Anti WNK3 pAb (ATL-HPA077678) Datasheet (External Link) |
| Vendor Page | Anti WNK3 pAb (ATL-HPA077678) at Atlas Antibodies |
| Documents & Links for Anti WNK3 pAb (ATL-HPA077678) | |
| Datasheet | Anti WNK3 pAb (ATL-HPA077678) Datasheet (External Link) |
| Vendor Page | Anti WNK3 pAb (ATL-HPA077678) |