Anti WNK3 pAb (ATL-HPA077678)

Atlas Antibodies

SKU:
ATL-HPA077678-25
  • Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: WNK lysine deficient protein kinase 3
Gene Name: WNK3
Alternative Gene Name: PRKWNK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041245: 59%, ENSRNOG00000002537: 41%
Entrez Gene ID: 65267
Uniprot ID: Q9BYP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV
Gene Sequence SSQPSVAYSSNQTMGSQMVSNIPQAEVNVPGQIYSSQQLVGHYQQVSGLQKHSKLTQPQILPLVQGQSTVLPVHVLGPTVVSQPQVSPLTVQKV
Gene ID - Mouse ENSMUSG00000041245
Gene ID - Rat ENSRNOG00000002537
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti WNK3 pAb (ATL-HPA077678)
Datasheet Anti WNK3 pAb (ATL-HPA077678) Datasheet (External Link)
Vendor Page Anti WNK3 pAb (ATL-HPA077678) at Atlas Antibodies

Documents & Links for Anti WNK3 pAb (ATL-HPA077678)
Datasheet Anti WNK3 pAb (ATL-HPA077678) Datasheet (External Link)
Vendor Page Anti WNK3 pAb (ATL-HPA077678)