Anti WLS pAb (ATL-HPA069520)
Atlas Antibodies
- Catalog No.:
- ATL-HPA069520-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: WLS
Alternative Gene Name: C1orf139, EVI, FLJ23091, GPR177, mig-14, MRP, wls
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028173: 94%, ENSRNOG00000036816: 93%
Entrez Gene ID: 79971
Uniprot ID: Q5T9L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD |
Gene Sequence | LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD |
Gene ID - Mouse | ENSMUSG00000028173 |
Gene ID - Rat | ENSRNOG00000036816 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti WLS pAb (ATL-HPA069520) | |
Datasheet | Anti WLS pAb (ATL-HPA069520) Datasheet (External Link) |
Vendor Page | Anti WLS pAb (ATL-HPA069520) at Atlas Antibodies |
Documents & Links for Anti WLS pAb (ATL-HPA069520) | |
Datasheet | Anti WLS pAb (ATL-HPA069520) Datasheet (External Link) |
Vendor Page | Anti WLS pAb (ATL-HPA069520) |