Anti WLS pAb (ATL-HPA069520)

Atlas Antibodies

Catalog No.: ATL-HPA069520-100

Protein Description: wntless Wnt ligand secretion mediator
Gene Name: WLS
Alternative Gene Name: C1orf139, EVI, FLJ23091, GPR177, mig-14, MRP, wls
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028173: 94%, ENSRNOG00000036816: 93%
Entrez Gene ID: 79971
Uniprot ID: Q5T9L3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
• Gene Sequence: LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD
• Gene ID - Mouse: ENSMUSG00000028173
• Gene ID - Rat: ENSRNOG00000036816
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.