Anti WISP3 pAb (ATL-HPA078340)

Atlas Antibodies

Catalog No.:
ATL-HPA078340-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: WNT1 inducible signaling pathway protein 3
Gene Name: WISP3
Alternative Gene Name: CCN6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062074: 56%, ENSRNOG00000000597: 56%
Entrez Gene ID: 8838
Uniprot ID: O95389
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV
Gene Sequence GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV
Gene ID - Mouse ENSMUSG00000062074
Gene ID - Rat ENSRNOG00000000597
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WISP3 pAb (ATL-HPA078340)
Datasheet Anti WISP3 pAb (ATL-HPA078340) Datasheet (External Link)
Vendor Page Anti WISP3 pAb (ATL-HPA078340) at Atlas Antibodies

Documents & Links for Anti WISP3 pAb (ATL-HPA078340)
Datasheet Anti WISP3 pAb (ATL-HPA078340) Datasheet (External Link)
Vendor Page Anti WISP3 pAb (ATL-HPA078340)