Anti WISP1 pAb (ATL-HPA007121)

Atlas Antibodies

Catalog No.: ATL-HPA007121-25

Protein Description: WNT1 inducible signaling pathway protein 1
Gene Name: WISP1
Alternative Gene Name: CCN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005124: 79%, ENSRNOG00000007078: 79%
Entrez Gene ID: 8840
Uniprot ID: O95388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAF
• Gene Sequence: QVVGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAVGCTPLCLRVRPPRLWCPHPRRVSIPGHCCEQWVCEDDAKRPRKTAPRDTGAF
• Gene ID - Mouse: ENSMUSG00000005124
• Gene ID - Rat: ENSRNOG00000007078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WISP1 pAb (ATL-HPA007121) – 1 Found

Deng, Wentao; Fernandez, Audry; McLaughlin, Sarah L; Klinke, David J 2nd. WNT1-inducible signaling pathway protein 1 (WISP1/CCN4) stimulates melanoma invasion and metastasis by promoting the epithelial-mesenchymal transition. The Journal Of Biological Chemistry. 2019;294(14):5261-5280.