Anti WIPI2 pAb (ATL-HPA021488)

Atlas Antibodies

Catalog No.:
ATL-HPA021488-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WD repeat domain, phosphoinositide interacting 2
Gene Name: WIPI2
Alternative Gene Name: ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029578: 99%, ENSRNOG00000001114: 100%
Entrez Gene ID: 26100
Uniprot ID: Q9Y4P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVF
Gene Sequence MKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVF
Gene ID - Mouse ENSMUSG00000029578
Gene ID - Rat ENSRNOG00000001114
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WIPI2 pAb (ATL-HPA021488)
Datasheet Anti WIPI2 pAb (ATL-HPA021488) Datasheet (External Link)
Vendor Page Anti WIPI2 pAb (ATL-HPA021488) at Atlas Antibodies

Documents & Links for Anti WIPI2 pAb (ATL-HPA021488)
Datasheet Anti WIPI2 pAb (ATL-HPA021488) Datasheet (External Link)
Vendor Page Anti WIPI2 pAb (ATL-HPA021488)
Citations for Anti WIPI2 pAb (ATL-HPA021488) – 1 Found
Biazik, Joanna; Ylä-Anttila, Päivi; Vihinen, Helena; Jokitalo, Eija; Eskelinen, Eeva-Liisa. Ultrastructural relationship of the phagophore with surrounding organelles. Autophagy. 11(3):439-51.  PubMed