Anti WIPI2 pAb (ATL-HPA021488)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021488-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WIPI2
Alternative Gene Name: ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029578: 99%, ENSRNOG00000001114: 100%
Entrez Gene ID: 26100
Uniprot ID: Q9Y4P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVF |
| Gene Sequence | MKVLHTIRETPPNPAGLCALSINNDNCYLAYPGSATIGEVQVFDTINLRAANMIPAHDSPLAALAFDASGTKLATASEKGTVIRVF |
| Gene ID - Mouse | ENSMUSG00000029578 |
| Gene ID - Rat | ENSRNOG00000001114 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WIPI2 pAb (ATL-HPA021488) | |
| Datasheet | Anti WIPI2 pAb (ATL-HPA021488) Datasheet (External Link) |
| Vendor Page | Anti WIPI2 pAb (ATL-HPA021488) at Atlas Antibodies |
| Documents & Links for Anti WIPI2 pAb (ATL-HPA021488) | |
| Datasheet | Anti WIPI2 pAb (ATL-HPA021488) Datasheet (External Link) |
| Vendor Page | Anti WIPI2 pAb (ATL-HPA021488) |
| Citations for Anti WIPI2 pAb (ATL-HPA021488) – 1 Found |
| Biazik, Joanna; Ylä-Anttila, Päivi; Vihinen, Helena; Jokitalo, Eija; Eskelinen, Eeva-Liisa. Ultrastructural relationship of the phagophore with surrounding organelles. Autophagy. 11(3):439-51. PubMed |