Anti WIPI2 pAb (ATL-HPA019852)

Atlas Antibodies

Catalog No.: ATL-HPA019852-25

Protein Description: WD repeat domain, phosphoinositide interacting 2
Gene Name: WIPI2
Alternative Gene Name: ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029578: 83%, ENSRNOG00000001114: 84%
Entrez Gene ID: 26100
Uniprot ID: Q9Y4P8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
• Gene Sequence: ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD
• Gene ID - Mouse: ENSMUSG00000029578
• Gene ID - Rat: ENSRNOG00000001114
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WIPI2 pAb (ATL-HPA019852) – 2 Found

Bansal, Megha; Moharir, Shivranjani C; Sailasree, S Purnima; Sirohi, Kapil; Sudhakar, Cherukuri; Sarathi, D Partha; Lakshmi, B Jyothi; Buono, Mario; Kumar, Satish; Swarup, Ghanshyam. Optineurin promotes autophagosome formation by recruiting the autophagy-related Atg12-5-16L1 complex to phagophores containing the Wipi2 protein. The Journal Of Biological Chemistry. 2018;293(1):132-147. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.