Anti WIPF2 pAb (ATL-HPA024467 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024467-25

Protein Description: WAS/WASL interacting protein family, member 2
Gene Name: WIPF2
Alternative Gene Name: WICH, WIRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038013: 99%, ENSRNOG00000027849: 97%
Entrez Gene ID: 147179
Uniprot ID: Q8TF74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQ
• Gene Sequence: PPPYRMHGSEPPSRGKPPPPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQ
• Gene ID - Mouse: ENSMUSG00000038013
• Gene ID - Rat: ENSRNOG00000027849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti WIPF2 pAb (ATL-HPA024467 w/enhanced validation) – 6 Found

Kovacs, Eva M; Verma, Suzie; Ali, Radiya G; Ratheesh, Aparna; Hamilton, Nicholas A; Akhmanova, Anna; Yap, Alpha S. N-WASP regulates the epithelial junctional actin cytoskeleton through a non-canonical post-nucleation pathway. Nature Cell Biology. 2011;13(8):934-43. 

Wu, Selwin K; Gomez, Guillermo A; Michael, Magdalene; Verma, Suzie; Cox, Hayley L; Lefevre, James G; Parton, Robert G; Hamilton, Nicholas A; Neufeld, Zoltan; Yap, Alpha S. Cortical F-actin stabilization generates apical-lateral patterns of junctional contractility that integrate cells into epithelia. Nature Cell Biology. 2014;16(2):167-78. 

Wu, Selwin K; Lagendijk, Anne K; Hogan, Benjamin M; Gomez, Guillermo A; Yap, Alpha S. Active contractility at E-cadherin junctions and its implications for cell extrusion in cancer. Cell Cycle (Georgetown, Tex.). 14(3):315-22. 

Van Itallie, Christina M; Tietgens, Amber Jean; Krystofiak, Evan; Kachar, Bechara; Anderson, James M. A complex of ZO-1 and the BAR-domain protein TOCA-1 regulates actin assembly at the tight junction. Molecular Biology Of The Cell. 2015;26(15):2769-87. 

García, Esther; Ragazzini, Chiara; Yu, Xinzi; Cuesta-García, Elena; Bernardino de la Serna, Jorge; Zech, Tobias; Sarrió, David; Machesky, Laura M; Antón, Inés M. WIP and WICH/WIRE co-ordinately control invadopodium formation and maturation in human breast cancer cell invasion. Scientific Reports. 2016;6( 27009365):23590. 

Ghibaudi, Matilde; Boido, Marina; Green, Darrell; Signorino, Elena; Berto, Gaia Elena; Pourshayesteh, Soraya; Singh, Archana; Di Cunto, Ferdinando; Dalmay, Tamas; Vercelli, Alessandro. miR-7b-3p Exerts a Dual Role After Spinal Cord Injury, by Supporting Plasticity and Neuroprotection at Cortical Level. Frontiers In Molecular Biosciences. 8( 33869277):618869.