Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA024000-25

Protein Description: WAS/WASL interacting protein family, member 2
Gene Name: WIPF2
Alternative Gene Name: WICH, WIRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038013: 99%, ENSRNOG00000027849: 97%
Entrez Gene ID: 147179
Uniprot ID: Q8TF74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP
• Gene Sequence: PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP
• Gene ID - Mouse: ENSMUSG00000038013
• Gene ID - Rat: ENSRNOG00000027849
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.