Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA024000-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: WAS/WASL interacting protein family, member 2
Gene Name: WIPF2
Alternative Gene Name: WICH, WIRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038013: 99%, ENSRNOG00000027849: 97%
Entrez Gene ID: 147179
Uniprot ID: Q8TF74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP
Gene Sequence PVNIRTGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPTSASPSLLSNRPPP
Gene ID - Mouse ENSMUSG00000038013
Gene ID - Rat ENSRNOG00000027849
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation)
Datasheet Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation)
Datasheet Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti WIPF2 pAb (ATL-HPA024000 w/enhanced validation)