Anti WFS1 pAb (ATL-HPA029128)

Atlas Antibodies

Catalog No.: ATL-HPA029128-25

Protein Description: Wolfram syndrome 1 (wolframin)
Gene Name: WFS1
Alternative Gene Name: DFNA14, DFNA38, DFNA6, DIDMOAD, WFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039474: 88%, ENSRNOG00000005108: 88%
Entrez Gene ID: 7466
Uniprot ID: O76024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW
• Gene Sequence: KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW
• Gene ID - Mouse: ENSMUSG00000039474
• Gene ID - Rat: ENSRNOG00000005108
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.