Anti WFS1 pAb (ATL-HPA029128)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029128-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: WFS1
Alternative Gene Name: DFNA14, DFNA38, DFNA6, DIDMOAD, WFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039474: 88%, ENSRNOG00000005108: 88%
Entrez Gene ID: 7466
Uniprot ID: O76024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW |
| Gene Sequence | KHPCHIKKFDRYKFEITVGMPFSSGADGSRSREEDDVTKDIVLRASSEFKSVLLSLRQGSLIEFSTILEGRLGSKWPVFELKAISCLNCMAQLSPTRRHVKIEHDW |
| Gene ID - Mouse | ENSMUSG00000039474 |
| Gene ID - Rat | ENSRNOG00000005108 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti WFS1 pAb (ATL-HPA029128) | |
| Datasheet | Anti WFS1 pAb (ATL-HPA029128) Datasheet (External Link) |
| Vendor Page | Anti WFS1 pAb (ATL-HPA029128) at Atlas Antibodies |
| Documents & Links for Anti WFS1 pAb (ATL-HPA029128) | |
| Datasheet | Anti WFS1 pAb (ATL-HPA029128) Datasheet (External Link) |
| Vendor Page | Anti WFS1 pAb (ATL-HPA029128) |